MMP7
Functional Attributes in Pathways
-
Substrates : 126 entries in CutDB for M10.008
Ext
-
Aggrecan 1 isoform 2 precursor
-
alpha 1 type II collagen isoform 1
-
alpha 1 type XVIII collagen isoform 1 precursor
-
alpha-2-HS-glycoprotei
-
alpha1-proteinase inhibitor (Homo sapiens)
-
apolipoprotein A-I preproprotein
-
apolipoprotein C-II precursor
-
brain derived neurotrophic factor
-
Brevican core protein precursor
-
cadherin 1, type 1 preproprotein
-
Cartilage linking protein 1
-
chondroitin sulfate proteoglycan 2 (versican)
-
Collagen alpha-2(I) chain precursor
-
connective tissue growth factor
-
cryptdin-1
-
cryptdin-4
-
Decorin isoform a preproprotein
-
defensin related cryptdin 4
-
fas ligand
-
Fas ligand (TNF superfamily, member 6)
-
fibrinogen, alpha chain isoform alpha preproprotein
-
fibrinogen, alpha polypeptide isoform alpha preproprotein
-
fibrinogen, alpha polypeptide isoform alpha-E preproprotein
-
fibrinogen, beta chain preproprotein
-
fibrinogen, gamma chain isoform gamma-A precursor
-
fibrinogen, gamma chain isoform gamma-B precursor
-
heparin-binding EGF growth factor
-
IgG1 heavy chain (hinge region)
-
IGHG1 protein
-
insulin-like growth factor binding protein 1 isoform a precursor
-
insulin-like growth factor binding protein 2, 36kDa
-
insulin-like growth factor binding protein 3 isoform a precursor
-
Integrin beta 4 isoform 1 precursor
-
laminin subunit beta 3 precursor
-
laminin, alpha 1 precursor
-
Matrix metalloproteinase 1 preproprotein
-
matrix metalloproteinase 7 preproprotein
-
matrix metalloproteinase 9 preproprotein
-
myelin associated glycoprotein isoform a precursor
-
myelin associated glycoprotein isoform b precursor
-
nerve growth factor, beta polypeptide precursor
-
nidogen (Mus musculus)
-
nidogen 1
-
nidogen 1 (Mus musculus)
-
Nidogen-1 precursor (Entactin)
-
Plasminogen
-
platelet/endothelial cell adhesion molecule (CD31 antigen)
-
Secreted phosphoprotein 1
-
secreted protein, acidic, cysteine-rich (osteonectin)
-
Serine (or cysteine) proteinase inhibitor, clade a (alpha-1 antiproteinase, antitrypsin), member 1
-
serine (or cysteine) proteinase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1
-
synaptosomal-associated protein 25 isoform SNAP25A
-
synaptosomal-associated protein 25 isoform SNAP25B
-
tenascin C (hexabrachion)
-
Tissue factor pathway inhibitor (lipoprotein-associated coagulation inhibitor) isoform a
-
Tumor necrosis factor receptor superfamily member 6 precursor
-
tumor necrosis factor receptor superfamily, member 6 isoform 1 precursor
-
urokinase plasminogen activator preproprotein
-
vascular endothelial growth factor A isoform 2 precursor
-
vitronectin precursor
-
Substrate Specificity -- Under development
-
Inhibitors -- Under development
-
Pathways -- Under development
Recent News and Literature
- [Effects of angiotensin converting...Zhonghua Wei Chang Wai Ke Za Zhi. 2008 Nov;11(6):565-8.
- [DDP-sensitivity-related genes in 10 lung...Zhonghua Zhong Liu Za Zhi. 2008 Jun;30(6):418-21.
- Reck forms cowbell-shaped dimers...J Biol Chem. 2008 Nov 20.
- LPA receptor 2 mediates...Gynecol Oncol. 2008 Nov 17.
- Matrix metalloproteinase 7 is required...Lab Invest. 2008 Nov 10.
- [Effects of Tamoxifen on Apoptosis...Ai Zheng. 2008 Nov;27(11):1172-6.
- Study of matrix metalloproteinases...Histopathology. 2008 Oct;53(4):403-15.
- Enhanced systemic matrix metalloproteinase...Ann Med. 2008 Oct 31:1-8.
- Polymorphisms of matrix metalloproteinase-7...J Gastroenterol. 2008;43(10):751-61. Epub 2008 Oct 29.
- Identification of amino acid...J Biol Chem. 2008 Oct 27.
- Active matrix metalloproteinase-7 is associated...Mod Pathol. 2008 Oct 17.
- Enhanced expression of trophinin...J Cancer Res Clin Oncol. 2008 Oct 10.
- Predictive value of MMP-7...Cancer Sci. 2008 Sep 23.
- Genetic polymorphisms in the MMP-7...Int J Cancer. 2008 Sep 16.
- Wnt1 overexpression promotes tumour...Eur J Cancer. 2008 Nov;44(17):2680-8. Epub 2008 Sep 13.
- No Association of MMP-7,...Cancer Epidemiol Biomarkers Prev. 2008 Sep;17(9):2514-8.
- Matrilysin (MMP-7) Is a Novel...Clin Cancer Res. 2008 Sep 1;14(17):5503-5511.
- Diallyl trisulfide increases the effectiveness...Mol Cancer Ther. 2008 Aug;7(8):2328-38.
- HRCT and histopathological evaluation...Respir Med. 2008 Dec;102(12):1753-61. Epub 2008 Aug 23.
- Matrilysin (matrix metalloprotease-7) cleaves...FEBS J. 2008 Aug 20.
Structural Features
MRLTVLCAVCLLPGSLALPLPQEAGGMSELQWEQAQDYLKRFYLYDSETKNANSLEAKLKEMQKFFGLPITGMLNSRVIE
IMQKPRCGVPDVAEYSLFPNSPKWTSKVVTYRIVSYTRDLPHITVDRLVSKALNMWGKEIPLHFRKVVWGTADIMIGFAR
GAHGDSYPFDGPGNTLAHAFAPGTGLGGDAHFDEDERWTDGSSLGINFLYAATHELGHSLGMGHSSDPNAVMYPTYGNGD
PQNFKLSQDDIKGIQKLYGKRSNSRKK
Cross annotation in other databases
MMP7 in:
Gene Cards
- Diseases
- Expression
- SNP
- Drugs
Other Links
- Human Protein Atlas
- iHOP
- GNF Sym Atlas
- NCBI Homologs
- OMIM
- MEROPS
Functional Attributes in Pathways
-
Substrates : 126 entries in CutDB for M10.008
Ext
- Aggrecan 1 isoform 2 precursor
- alpha 1 type II collagen isoform 1
- alpha 1 type XVIII collagen isoform 1 precursor
- alpha-2-HS-glycoprotei
- alpha1-proteinase inhibitor (Homo sapiens)
- apolipoprotein A-I preproprotein
- apolipoprotein C-II precursor
- brain derived neurotrophic factor
- Brevican core protein precursor
- cadherin 1, type 1 preproprotein
- Cartilage linking protein 1
- chondroitin sulfate proteoglycan 2 (versican)
- Collagen alpha-2(I) chain precursor
- connective tissue growth factor
- cryptdin-1
- cryptdin-4
- Decorin isoform a preproprotein
- defensin related cryptdin 4
- fas ligand
- Fas ligand (TNF superfamily, member 6)
- fibrinogen, alpha chain isoform alpha preproprotein
- fibrinogen, alpha polypeptide isoform alpha preproprotein
- fibrinogen, alpha polypeptide isoform alpha-E preproprotein
- fibrinogen, beta chain preproprotein
- fibrinogen, gamma chain isoform gamma-A precursor
- fibrinogen, gamma chain isoform gamma-B precursor
- heparin-binding EGF growth factor
- IgG1 heavy chain (hinge region)
- IGHG1 protein
- insulin-like growth factor binding protein 1 isoform a precursor
- insulin-like growth factor binding protein 2, 36kDa
- insulin-like growth factor binding protein 3 isoform a precursor
- Integrin beta 4 isoform 1 precursor
- laminin subunit beta 3 precursor
- laminin, alpha 1 precursor
- Matrix metalloproteinase 1 preproprotein
- matrix metalloproteinase 7 preproprotein
- matrix metalloproteinase 9 preproprotein
- myelin associated glycoprotein isoform a precursor
- myelin associated glycoprotein isoform b precursor
- nerve growth factor, beta polypeptide precursor
- nidogen (Mus musculus)
- nidogen 1
- nidogen 1 (Mus musculus)
- Nidogen-1 precursor (Entactin)
- Plasminogen
- platelet/endothelial cell adhesion molecule (CD31 antigen)
- Secreted phosphoprotein 1
- secreted protein, acidic, cysteine-rich (osteonectin)
- Serine (or cysteine) proteinase inhibitor, clade a (alpha-1 antiproteinase, antitrypsin), member 1
- serine (or cysteine) proteinase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1
- synaptosomal-associated protein 25 isoform SNAP25A
- synaptosomal-associated protein 25 isoform SNAP25B
- tenascin C (hexabrachion)
- Tissue factor pathway inhibitor (lipoprotein-associated coagulation inhibitor) isoform a
- Tumor necrosis factor receptor superfamily member 6 precursor
- tumor necrosis factor receptor superfamily, member 6 isoform 1 precursor
- urokinase plasminogen activator preproprotein
- vascular endothelial growth factor A isoform 2 precursor
- vitronectin precursor
- Substrate Specificity -- Under development
- Inhibitors -- Under development
- Pathways -- Under development
Recent News and Literature
- [Effects of angiotensin converting...Zhonghua Wei Chang Wai Ke Za Zhi. 2008 Nov;11(6):565-8.
- [DDP-sensitivity-related genes in 10 lung...Zhonghua Zhong Liu Za Zhi. 2008 Jun;30(6):418-21.
- Reck forms cowbell-shaped dimers...J Biol Chem. 2008 Nov 20.
- LPA receptor 2 mediates...Gynecol Oncol. 2008 Nov 17.
- Matrix metalloproteinase 7 is required...Lab Invest. 2008 Nov 10.
- [Effects of Tamoxifen on Apoptosis...Ai Zheng. 2008 Nov;27(11):1172-6.
- Study of matrix metalloproteinases...Histopathology. 2008 Oct;53(4):403-15.
- Enhanced systemic matrix metalloproteinase...Ann Med. 2008 Oct 31:1-8.
- Polymorphisms of matrix metalloproteinase-7...J Gastroenterol. 2008;43(10):751-61. Epub 2008 Oct 29.
- Identification of amino acid...J Biol Chem. 2008 Oct 27.
- Active matrix metalloproteinase-7 is associated...Mod Pathol. 2008 Oct 17.
- Enhanced expression of trophinin...J Cancer Res Clin Oncol. 2008 Oct 10.
- Predictive value of MMP-7...Cancer Sci. 2008 Sep 23.
- Genetic polymorphisms in the MMP-7...Int J Cancer. 2008 Sep 16.
- Wnt1 overexpression promotes tumour...Eur J Cancer. 2008 Nov;44(17):2680-8. Epub 2008 Sep 13.
- No Association of MMP-7,...Cancer Epidemiol Biomarkers Prev. 2008 Sep;17(9):2514-8.
- Matrilysin (MMP-7) Is a Novel...Clin Cancer Res. 2008 Sep 1;14(17):5503-5511.
- Diallyl trisulfide increases the effectiveness...Mol Cancer Ther. 2008 Aug;7(8):2328-38.
- HRCT and histopathological evaluation...Respir Med. 2008 Dec;102(12):1753-61. Epub 2008 Aug 23.
- Matrilysin (matrix metalloprotease-7) cleaves...FEBS J. 2008 Aug 20.
Structural Features
MRLTVLCAVCLLPGSLALPLPQEAGGMSELQWEQAQDYLKRFYLYDSETKNANSLEAKLKEMQKFFGLPITGMLNSRVIE
IMQKPRCGVPDVAEYSLFPNSPKWTSKVVTYRIVSYTRDLPHITVDRLVSKALNMWGKEIPLHFRKVVWGTADIMIGFAR
GAHGDSYPFDGPGNTLAHAFAPGTGLGGDAHFDEDERWTDGSSLGINFLYAATHELGHSLGMGHSSDPNAVMYPTYGNGD
PQNFKLSQDDIKGIQKLYGKRSNSRKK
Cross annotation in other databases
MMP7 in:
- Gene Cards
- Diseases
- Expression
- SNP
- Drugs
- Other Links
- Human Protein Atlas
- iHOP
- GNF Sym Atlas
- NCBI Homologs
- OMIM
- MEROPS

