MMP12

Functional Attributes in Pathways

Recent News and Literature

  1. The interaction of monocytes...Immunology. 2008 Nov 14.
  2. Immunohistochemical study of lung...J Bras Pneumol. 2008 Oct;34(10):787-95.
  3. No Association of MMP-7,...Cancer Epidemiol Biomarkers Prev. 2008 Sep;17(9):2514-8.
  4. Inactivation of N-TIMP-1 by N-terminal...Biopolymers. 2008 Nov;89(11):960-8.
  5. Serotonin regulates macrophage-mediated angiogenesis...Cancer Res. 2008 Jul 1;68(13):5152-8.
  6. Alveolar macrophage activation and an emphysema-like...Am J Physiol Lung Cell Mol Physiol. 2008 Jun;294(6):L1035-42. Epub 2008 Mar 7.
  7. Bone marrow stromal cells...Int J Cancer. 2008 Mar 6;.
  8. Additional MDA-MB-231 breast cancer...J Cell Physiol. 2008 Aug;216(2):480-5.
  9. Matrix metalloproteinase single-nucleotide polymorphisms...Clin Cancer Res. 2007 Nov 15;13(22 Pt 1):6673-80.
  10. An integrated high-performance liquid...J Chromatogr A. 2008 May 2;1189(1-2):417-25. Epub 2007 Oct 25.
  11. EGCG inhibits growth, invasion,...Front Biosci. 2008 Jan 1;13:440-52.
  12. BeWo cells stimulate smooth...Hum Reprod. 2007 Nov;22(11):2834-41. Epub 2007 Sep 27.
  13. Biological effects of particles...Chem Res Toxicol. 2007 Oct;20(10):1426-33. Epub 2007 Sep 21.
  14. Involvement of specific matrix...Mol Cancer Ther. 2007 Sep;6(9):2563-71.
  15. Functional modulation of Crohn's...Gastroenterology. 2007 Jul;133(1):137-49. Epub 2007 May 5.
  16. Clinical implications of matrix...J Gastroenterol Hepatol. 2007 Jul;22(7):1064-70.
  17. Platinum complexes can inhibit...J Med Chem. 2007 Jul 26;50(15):3434-41. Epub 2007 Jun 21.
  18. Increased expression of human...Pathol Res Pract. 2007;203(7):499-505. Epub 2007 Jun 14.
  19. Prognostic values of matrix...J Surg Res. 2008 May 1;146(1):32-42. Epub 2007 May 31.
  20. A new methodology for monitoring...J Am Soc Mass Spectrom. 2007 May;18(5):961-9. Epub 2007 Mar 23.

Structural Features

[-] Domain Structure

Homologs

Sequence

MKFLLILLLQATASGALPLNSSTSLEKNNVLFGERYLEKFYGLEINKLPVTKMKYSGNLMKEKIQEMQHFLGLKVTGQLD

TSTLEMMHAPRCGVPDVHHFREMPGGPVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKINTGMADIL

VVFARGAHGDFHAFDGKGGILAHAFGPGSGIGGDAHFDEDEFWTTHSGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTY

KYVDINTFRLSADDIRGIQSLYGDPKENQRLPNPDNSEPALCDPNLSFDAVTTVGNKIFFFKDRFFWLKVSERPKTSVNL

ISSLWPTLPSGIEAAYEIEARNQVFLFKDDKYWLISNLRPEPNYPKSIHSFGFPNFVKKIDAAVFNPRFYRTYFFVDNQY

WRYDERRQMMDPGYPKLITKNFQGIGPKIDAVFYSKNKYYYFFQGSNQFEYDFLLQRITKTLKSNSWFGC

Cross annotation in other databases

MMP12 in: