matrix metallopeptidase-9
Functional Attributes in Pathways
-
Substrates : 375 entries in CutDB for M10.004
Ext
-
small inducible cytokine B9 precursor
-
activated leukocyte cell adhesion molecule
-
aggrecan 1 isoform 1 precursor
-
aggrecan 1 isoform 2 precursor
-
Aggrecan 1 isoform 2 precursor
-
alpha 1 type I collagen preproprotein
-
alpha 1 type II collagen isoform 1
-
alpha 1 type II collagen isoform 2
-
alpha 1 type V collagen preproprotein
-
alpha 1 type XI collagen isoform A preproprotein
-
alpha 1 type XVIII collagen isoform 1 precursor
-
amyloid beta A4 protein precursor, isoform a
-
amyloid beta A4 protein precursor, isoform b
-
amyloid beta A4 protein precursor, isoform c
-
biglycan preproprotein
-
bone morphogenetic protein 8A preproprotein
-
bone morphogenetic protein 8B preproprotein
-
Cartilage linking protein 1
-
Chemokine (c-x-c motif) ligand 1
-
chemokine (C-X-C motif) ligand 1
-
chemokine (C-X-C motif) ligand 12 (stromal cell-derived factor 1) isoform alpha
-
chemokine (C-X-C motif) ligand 12 (stromal cell-derived factor 1) isoform beta
-
chemokine (C-X-C motif) ligand 12 (stromal cell-derived factor 1) isoform gamma
-
chemokine (C-X-C motif) ligand 5
-
chemokine (C-X-C motif) ligand 5 precursor
-
Chemokine (c-x-c motif) ligand 5 precursor
-
chemokine (C-X-C motif) ligand 6 (granulocyte chemotactic protein 2)
-
chondroitin sulfate proteoglycan 2 (versican)
-
clathrin heavy chain (Hc)
-
collagen type III alpha 1 preproprotein
-
collagen, type II, alpha 1 isoform 1 precursor
-
collagen, type II, alpha 1 isoform 2 precursor
-
collagen, type III, alpha 1 preproprotein
-
collagen, type IV, alpha 4
-
collagen, type VI, alpha 1 precursor
-
collagen, type VI, alpha 2
-
collagen, type XII, alpha 1 long isoform precursor
-
collagen, type XX, alpha 1
-
Complement C1q subcomponent subunit C
-
complement component 1, q subcomponent, A chain
-
complement component 1, q subcomponent, C chain
-
crystallin, alpha B
-
crystallin, beta B1
-
desmoglein 3 preproprotein
-
dystroglycan 1 precursor
-
enamelin
-
endothelin 1
-
Fc receptor-like 5
-
fibrillin 1
-
fibrillin 2 precursor
-
fibronectin (Homo sapiens)
-
fibronectin 1 isoform 1 preproprotein
-
fibronectin 1 isoform 2 preproprotein
-
fibronectin 1 isoform 3 preproprotein
-
fibronectin 1 isoform 4 preproprotein
-
fibronectin 1 isoform 5 preproprotein
-
fibronectin 1 isoform 6 preproprotein
-
fibronectin 1 isoform 7 preproprotein
-
Galectin 3
-
Golli-mbp isoform 1
-
granulin precursor
-
heat shock 90kDa protein 1, beta
-
insulin-like growth factor binding protein 1 isoform a precursor
-
insulin-like growth factor binding protein 3 isoform a precursor
-
integrin, alpha 3 (antigen CD49C, alpha 3 subunit of VLA-3 receptor)
-
intercellular adhesion molecule 5 precursor
-
interferon, beta 1
-
interleukin 22 receptor, alpha 1
-
Interleukin 8 precursor
-
Interleukin-8 precursor
-
Kiss-1 metastasis-suppressor
-
laminin, alpha 1 precursor
-
laminin, beta 1
-
latent transforming growth factor beta binding protein 1 isoform LTBP-1L
-
latent transforming growth factor beta binding protein 1 isoform LTBP-1S
-
lectin, galactoside-binding, soluble, 1 (galectin-1)
-
leukemia inhibitory factor
-
lysyl hydroxylase precursor
-
mannose binding lectin 1, protein A
-
matrix metalloproteinase 13 preproprotein
-
matrix metalloproteinase 9 preproprotein
-
Metastasis-suppressor KiSS-1 precursor
-
myelin basic protein isoform 1
-
myelin basic protein isoform 2
-
myelin basic protein isoform 3
-
myelin basic protein isoform 4
-
myelin basic protein isoform 5
-
myelin basic protein isoform 6
-
N-methyl-D-aspartate receptor subunit 2A precursor
-
neuronal pentraxin receptor
-
neuropilin 1 isoform a
-
Plasminogen
-
plasminogen activator inhibitor type 1, member 2
-
plasminogen activator inhibitor type 1, member 2 isoform a precursor
-
plasminogen activator inhibitor type 1, member 2 isoform b precursor
-
plasminogen activator inhibitor type 1, member 2 isoform c precursor
-
plasminogen activator, tissue type isoform 1 preproprotein
-
plasminogen activator, tissue type isoform 2 preproprotein
-
platelet factor 4 (chemokine (C-X-C motif) ligand 4)
-
platelet/endothelial cell adhesion molecule (CD31 antigen)
-
Pregnancy-zone protein
-
pro-platelet basic protein precursor
-
proinsulin precursor
-
Proinsulin precursor
-
prolactin
-
prosaposin
-
secreted protein, acidic, cysteine-rich (osteonectin)
-
semaphorin 7A, GPI membrane anchor (John Milton Hagen blood group)
-
serine (or cysteine) proteinase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1
-
small inducible cytokine B10 precursor
-
soluble mannose-binding lectin precursor
-
tachykinin 1 isoform alpha precursor
-
tachykinin 1 isoform beta precursor
-
tachykinin 1 isoform delta precursor
-
tachykinin 1 isoform gamma precursor
-
TEK tyrosine kinase, endothelial precursor
-
Tissue factor pathway inhibitor (lipoprotein-associated coagulation inhibitor) isoform a
-
tissue factor pathway inhibitor isoform b precursor
-
transforming growth factor, beta 1
-
vascular endothelial growth factor A isoform 2 precursor
-
versican isoform 1
-
vitronectin precursor
-
Substrate Specificity -- Under development
-
Inhibitors -- Under development
-
Pathways -- Under development
Recent News and Literature
We currently do not have custom news for this protein.
Structural Features
MSPWQPLLLALLAFGCSSAAPYQRQPTFVVFPKDLKTSNLTDTQLAEAYLYRYGYTRAAQMMGEKQSLRPALLMLQKQLS
LPQTGELDSQTLKAIRTPRCGVPDVGRFQTFKGLKWDHHNITYWIQNYSEDLPRDMIDDAFARAFAVWGEVAPLTFTRVY
GPEADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGAGVQGDAHFDDDELWSLGKGVVIPTYYGNSNGAPCHFPFTFEGRS
YSACTTDGRNDGTPWCSTTADYDKDGKFGFCPSERLYTEHGNGEGKPCVFPFIFEGRSYSACTTKGRSDGYRWCATTANY
DQDKLYGFCPTRVDATVVGGNSAGELCVFPFVFLGKQYSSCTSDGRRDGRLWCATTSNFDTDKKWGFCPDQGYSLFLVAA
HEFGHALGLDHSSVPEALMYPLYSYLEGFPLNKDDIDGIQYLYGRGSKPDPRPPATTTTEPQPTAPPTMCPTIPPTAYPT
VGPTVGPTGAPSPGPTSSPSPGPTGAPSPGPTAAPTAGSSEASTESLSPADNPCNVDVFDAIAEIQGALHFFKDGWYWKF
LNHRGSPLQGPFLTARTWPALPATLDSAFEDPQTKRVFFFSGRQMWVYTGKTVLGPRSLDKLGLGPEVTHVSGLLPRRPG
KALLFSKGRVWRFDLKSQKVDPQSVIRVDKEFSGVPWNSHDIFQYQDKAYFCHGKFFWRVSFQNEVNKVDPEVNQVDDVG
YVTYDLLQCP
Cross annotation in other databases
matrix metallopeptidase-9 in:
Gene Cards
- Diseases
- Expression
- SNP
- Drugs
Other Links
- Human Protein Atlas
- iHOP
- GNF Sym Atlas
- NCBI Homologs
- OMIM
- MEROPS
Functional Attributes in Pathways
-
Substrates : 375 entries in CutDB for M10.004
Ext
- small inducible cytokine B9 precursor
- activated leukocyte cell adhesion molecule
- aggrecan 1 isoform 1 precursor
- aggrecan 1 isoform 2 precursor
- Aggrecan 1 isoform 2 precursor
- alpha 1 type I collagen preproprotein
- alpha 1 type II collagen isoform 1
- alpha 1 type II collagen isoform 2
- alpha 1 type V collagen preproprotein
- alpha 1 type XI collagen isoform A preproprotein
- alpha 1 type XVIII collagen isoform 1 precursor
- amyloid beta A4 protein precursor, isoform a
- amyloid beta A4 protein precursor, isoform b
- amyloid beta A4 protein precursor, isoform c
- biglycan preproprotein
- bone morphogenetic protein 8A preproprotein
- bone morphogenetic protein 8B preproprotein
- Cartilage linking protein 1
- Chemokine (c-x-c motif) ligand 1
- chemokine (C-X-C motif) ligand 1
- chemokine (C-X-C motif) ligand 12 (stromal cell-derived factor 1) isoform alpha
- chemokine (C-X-C motif) ligand 12 (stromal cell-derived factor 1) isoform beta
- chemokine (C-X-C motif) ligand 12 (stromal cell-derived factor 1) isoform gamma
- chemokine (C-X-C motif) ligand 5
- chemokine (C-X-C motif) ligand 5 precursor
- Chemokine (c-x-c motif) ligand 5 precursor
- chemokine (C-X-C motif) ligand 6 (granulocyte chemotactic protein 2)
- chondroitin sulfate proteoglycan 2 (versican)
- clathrin heavy chain (Hc)
- collagen type III alpha 1 preproprotein
- collagen, type II, alpha 1 isoform 1 precursor
- collagen, type II, alpha 1 isoform 2 precursor
- collagen, type III, alpha 1 preproprotein
- collagen, type IV, alpha 4
- collagen, type VI, alpha 1 precursor
- collagen, type VI, alpha 2
- collagen, type XII, alpha 1 long isoform precursor
- collagen, type XX, alpha 1
- Complement C1q subcomponent subunit C
- complement component 1, q subcomponent, A chain
- complement component 1, q subcomponent, C chain
- crystallin, alpha B
- crystallin, beta B1
- desmoglein 3 preproprotein
- dystroglycan 1 precursor
- enamelin
- endothelin 1
- Fc receptor-like 5
- fibrillin 1
- fibrillin 2 precursor
- fibronectin (Homo sapiens)
- fibronectin 1 isoform 1 preproprotein
- fibronectin 1 isoform 2 preproprotein
- fibronectin 1 isoform 3 preproprotein
- fibronectin 1 isoform 4 preproprotein
- fibronectin 1 isoform 5 preproprotein
- fibronectin 1 isoform 6 preproprotein
- fibronectin 1 isoform 7 preproprotein
- Galectin 3
- Golli-mbp isoform 1
- granulin precursor
- heat shock 90kDa protein 1, beta
- insulin-like growth factor binding protein 1 isoform a precursor
- insulin-like growth factor binding protein 3 isoform a precursor
- integrin, alpha 3 (antigen CD49C, alpha 3 subunit of VLA-3 receptor)
- intercellular adhesion molecule 5 precursor
- interferon, beta 1
- interleukin 22 receptor, alpha 1
- Interleukin 8 precursor
- Interleukin-8 precursor
- Kiss-1 metastasis-suppressor
- laminin, alpha 1 precursor
- laminin, beta 1
- latent transforming growth factor beta binding protein 1 isoform LTBP-1L
- latent transforming growth factor beta binding protein 1 isoform LTBP-1S
- lectin, galactoside-binding, soluble, 1 (galectin-1)
- leukemia inhibitory factor
- lysyl hydroxylase precursor
- mannose binding lectin 1, protein A
- matrix metalloproteinase 13 preproprotein
- matrix metalloproteinase 9 preproprotein
- Metastasis-suppressor KiSS-1 precursor
- myelin basic protein isoform 1
- myelin basic protein isoform 2
- myelin basic protein isoform 3
- myelin basic protein isoform 4
- myelin basic protein isoform 5
- myelin basic protein isoform 6
- N-methyl-D-aspartate receptor subunit 2A precursor
- neuronal pentraxin receptor
- neuropilin 1 isoform a
- Plasminogen
- plasminogen activator inhibitor type 1, member 2
- plasminogen activator inhibitor type 1, member 2 isoform a precursor
- plasminogen activator inhibitor type 1, member 2 isoform b precursor
- plasminogen activator inhibitor type 1, member 2 isoform c precursor
- plasminogen activator, tissue type isoform 1 preproprotein
- plasminogen activator, tissue type isoform 2 preproprotein
- platelet factor 4 (chemokine (C-X-C motif) ligand 4)
- platelet/endothelial cell adhesion molecule (CD31 antigen)
- Pregnancy-zone protein
- pro-platelet basic protein precursor
- proinsulin precursor
- Proinsulin precursor
- prolactin
- prosaposin
- secreted protein, acidic, cysteine-rich (osteonectin)
- semaphorin 7A, GPI membrane anchor (John Milton Hagen blood group)
- serine (or cysteine) proteinase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1
- small inducible cytokine B10 precursor
- soluble mannose-binding lectin precursor
- tachykinin 1 isoform alpha precursor
- tachykinin 1 isoform beta precursor
- tachykinin 1 isoform delta precursor
- tachykinin 1 isoform gamma precursor
- TEK tyrosine kinase, endothelial precursor
- Tissue factor pathway inhibitor (lipoprotein-associated coagulation inhibitor) isoform a
- tissue factor pathway inhibitor isoform b precursor
- transforming growth factor, beta 1
- vascular endothelial growth factor A isoform 2 precursor
- versican isoform 1
- vitronectin precursor
- Substrate Specificity -- Under development
- Inhibitors -- Under development
- Pathways -- Under development
Recent News and Literature
Structural Features
MSPWQPLLLALLAFGCSSAAPYQRQPTFVVFPKDLKTSNLTDTQLAEAYLYRYGYTRAAQMMGEKQSLRPALLMLQKQLS
LPQTGELDSQTLKAIRTPRCGVPDVGRFQTFKGLKWDHHNITYWIQNYSEDLPRDMIDDAFARAFAVWGEVAPLTFTRVY
GPEADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGAGVQGDAHFDDDELWSLGKGVVIPTYYGNSNGAPCHFPFTFEGRS
YSACTTDGRNDGTPWCSTTADYDKDGKFGFCPSERLYTEHGNGEGKPCVFPFIFEGRSYSACTTKGRSDGYRWCATTANY
DQDKLYGFCPTRVDATVVGGNSAGELCVFPFVFLGKQYSSCTSDGRRDGRLWCATTSNFDTDKKWGFCPDQGYSLFLVAA
HEFGHALGLDHSSVPEALMYPLYSYLEGFPLNKDDIDGIQYLYGRGSKPDPRPPATTTTEPQPTAPPTMCPTIPPTAYPT
VGPTVGPTGAPSPGPTSSPSPGPTGAPSPGPTAAPTAGSSEASTESLSPADNPCNVDVFDAIAEIQGALHFFKDGWYWKF
LNHRGSPLQGPFLTARTWPALPATLDSAFEDPQTKRVFFFSGRQMWVYTGKTVLGPRSLDKLGLGPEVTHVSGLLPRRPG
KALLFSKGRVWRFDLKSQKVDPQSVIRVDKEFSGVPWNSHDIFQYQDKAYFCHGKFFWRVSFQNEVNKVDPEVNQVDDVG
YVTYDLLQCP
Cross annotation in other databases
matrix metallopeptidase-9 in:
- Gene Cards
- Diseases
- Expression
- SNP
- Drugs
- Other Links
- Human Protein Atlas
- iHOP
- GNF Sym Atlas
- NCBI Homologs
- OMIM
- MEROPS

