matrix metallopeptidase-2
Functional Attributes in Pathways
-
Substrates : 339 entries in CutDB for M10.003
Ext
-
Insulin-like growth factor-binding protein 6 precursor
-
secreted phosphoprotein 1 isoform a
-
secreted phosphoprotein 1 isoform b
-
3110003A17Rik protein
-
acetyl-Coenzyme A acetyltransferase 2
-
Adrenomedulin
-
Aggrecan 1 isoform 2 precursor
-
alanyl-tRNA synthetase
-
aldo-keto reductase family 1, member B1
-
aldolase C, fructose-bisphosphate
-
Alpha-2-macroglobulin precursor
-
alpha-actinin-1
-
amyloid beta A4 protein precursor, isoform a
-
amyloid-like protein 2
-
angiopoietin-related protein 2
-
antioxidant protein 1
-
APEX nuclease 1
-
basophilic leukemia expressed protein BLES03
-
beta-galactoside-binding lectin precursor
-
biglycan
-
bisphosphoglycerate mutase 1
-
BolA-2 protein
-
Brevican core protein precursor
-
calcitonin-related polypeptide, beta
-
calpain 2
-
calponin 3, acidic
-
capping protein (actin filament), gelsolin-like
-
Cartilage linking protein 1
-
cartilage linking protein 1
-
cathepsin A isoform a
-
cathepsin A isoform b
-
cathepsin L1
-
chemokine (C-C motif) ligand 7 precursor
-
chemokine (C-X-C motif) ligand 12 (stromal cell-derived factor 1) isoform alpha
-
chemokine (C-X-C motif) ligand 12 (stromal cell-derived factor 1) isoform beta
-
chemokine (C-X-C motif) ligand 5
-
chemokine (C-X3-C motif) ligand 1
-
chondroitin sulfate proteoglycan 2 (versican)
-
chromobox homolog 5
-
cofilin 1, non-muscle
-
collagen type III alpha 1 preproprotein
-
collagen, type I, alpha 1
-
collagen, type I, alpha 2
-
collagen, type II, alpha 1 isoform 1 precursor
-
collagen, type II, alpha 1 isoform 2 precursor
-
collagen, type VI, alpha 1
-
complement component 1, q subcomponent, A chain
-
complement component 1, q subcomponent, B chain
-
complement component 1, q subcomponent, C chain
-
complement component 3
-
connective tissue growth factor
-
cystatin C precursor
-
cystatin E/M
-
cysteinyl-tRNA synthetase
-
cytosol aminopeptidase
-
decorin isoform a preproprotein
-
decorin isoform b precursor
-
decorin isoform c precursor
-
delta-aminolevulinic acid dehydratase
-
dentin sialophosphoprotein preproprotein
-
dermatopontin
-
desmoglein 3 preproprotein
-
dihydropyrimidinase-like 3 isoform 1
-
dihydropyrimidinase-like 3 isoform 2
-
dystroglycan 1 precursor
-
endothelin 1
-
enolase 2, gamma neuronal
-
ephrin receptor EphB1 precursor
-
ErbB3-binding protein 1
-
eukaryotic translation elongation factor 1 gamma
-
eukaryotic translation elongation factor 2
-
eukaryotic translation initiation factor 1
-
eukaryotic translation initiation factor 5A2
-
exportin 1, CRM1 homolog
-
extracellular matrix protein 1
-
far upstream element (FUSE) binding protein 1
-
fast myosin alkali light chain 1f
-
fast myosin alkali light chain 3f
-
fatty acid binding protein 5, epidermal
-
fibrillin 1 precursor
-
fibrillin 2 precursor
-
fibroblast growth factor receptor 1 isoform 1 precursor
-
fibronectin 1
-
filamin B, beta
-
filamin C, gamma
-
filamin-A
-
FK506 binding protein 52
-
follistatin-like 1 precursor
-
follistatin-related protein 1
-
fructose-bisphosphate aldolase A
-
Galectin 3
-
gelsolin
-
glucosamine-6-phosphate deaminase 1
-
glucose phosphate isomerase 1
-
glyceraldehyde-3-phosphate dehydrogenase
-
glypican 1
-
Golli-mbp isoform 1
-
Golli-mbp isoform 2
-
granulin
-
growth arrest-specific protein 1
-
guanine nucleotide binding protein (G protein), beta polypeptide 2 like 1
-
guanosine diphosphate (GDP) dissociation inhibitor 2
-
heat shock 105kD
-
heat shock protein 4
-
heat shock protein 8
-
heat shock protein 90kDa alpha (cytosolic), class A member 1 isoform 1
-
heat shock protein 90kDa alpha (cytosolic), class A member 1 isoform 2
-
heterogeneous nuclear ribonucleoprotein D isoform a
-
heterogeneous nuclear ribonucleoprotein D isoform b
-
heterogeneous nuclear ribonucleoprotein D isoform c
-
heterogeneous nuclear ribonucleoprotein D isoform d
-
heterogeneous nuclear ribonucleoprotein F
-
histocompatibility 2, D region locus 1
-
HLA-B-associated transcript 1A
-
Hsc70-interacting protein
-
immunoglobulin light chain, lambda gene cluster
-
inositol (myo)-1(or 4)-monophosphatase 1
-
insulin-like growth factor binding protein 1 isoform a precursor
-
Insulin-like growth factor binding protein 3 isoform b precursor
-
insulin-like growth factor binding protein 4
-
insulin-like growth factor binding protein 5
-
insulin-like growth factor binding protein 6
-
insulin-like growth factor binding protein 7 isoform 1
-
insulin-like growth factor binding protein 7 isoform 2
-
intercellular adhesion molecule 5 precursor
-
Interleukin 1, beta proprotein
-
karyopherin (importin) alpha 3
-
karyopherin beta 1
-
Kiss-1 metastasis-suppressor
-
L-lactate dehydrogenase A chain
-
L-lactate dehydrogenase B
-
lamin A isoform A
-
laminin, alpha 1 precursor
-
laminin, gamma 2
-
latent transforming growth factor beta binding protein 1 isoform LTBP-1L
-
latent transforming growth factor beta binding protein 1 isoform LTBP-1S
-
LIM domain and actin-binding protein 1
-
Lupus La protein homolog
-
malate dehydrogenase, mitochondrial
-
mannose binding lectin 1, protein A
-
matrix metalloproteinase 13 preproprotein
-
matrix metalloproteinase 2
-
matrix metalloproteinase 2 preproprotein
-
matrix metalloproteinase 9 preproprotein
-
matrix metalloproteinase-11
-
Metastasis-suppressor KiSS-1 precursor
-
methionine aminopeptidase 2
-
moesin
-
Myelin basic protein
-
myelin basic protein isoform 1
-
myelin basic protein isoform 2
-
myelin basic protein isoform 3
-
myelin basic protein isoform 4
-
NAD(P)H dehydrogenase, quinone 1
-
nidogen-1
-
nucleolin
-
nucleoside diphosphate kinase B
-
osteoglycin
-
pancreatic trypsin inhibitor
-
Parkinson disease protein 7
-
periostin
-
phosphoglycerate dehydrogenase
-
phosphoglycerate kinase 1
-
phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoimidazole succinocarboxamide synthetase
-
plasminogen activator, urokinase
-
platelet-derived growth factor receptor-like protein
-
pleiotrophin
-
poly(A) binding protein, cytoplasmic 1
-
poly(rC) binding protein 1
-
Pregnancy-zone protein
-
procollagen C-proteinase enhancer protein
-
procollagen, type IV, alpha 2 preproprotein
-
profilin 1
-
prolactin
-
prolactin family 2, subfamily c, member 3
-
prolyl endopeptidase
-
proteasome (prosome, macropain) subunit, alpha type 1
-
proteasome (prosome, macropain) subunit, alpha type 3
-
proteasome (prosome, macropain) subunit, beta type 1
-
protein phosphatase 1, catalytic subunit, gamma isoform
-
purine-nucleoside phosphorylase 1
-
pyruvate kinase, muscle
-
RAN binding protein 1
-
Rho GDP dissociation inhibitor (GDI) alpha
-
ribonuclease/angiogenin inhibitor 1
-
ribosomal protein S12
-
ribosomal protein S4, X-linked
-
ribosomal protein S5
-
S-formylglutathione hydrolase
-
S100 calcium binding protein A11 (calizzarin)
-
secreted phosphoprotein 1 isoform c
-
secreted protein, acidic, cysteine-rich (osteonectin)
-
serum albumin
-
Serum amyloid a2
-
soluble mannose-binding lectin precursor
-
synaptotagmin binding, cytoplasmic RNA interacting protein isoform 1
-
synaptotagmin binding, cytoplasmic RNA interacting protein isoform 2
-
tenascin C (hexabrachion)
-
thioredoxin 1
-
thrombospondin 2
-
thymic stromal lymphopoietin
-
transferrin
-
transforming growth factor, beta 1
-
transglutaminase 2 isoform a
-
triosephosphate isomerase 1
-
tropomyosin 1, alpha
-
tubulin, alpha 4
-
tubulin, beta 4
-
twinfilin-like protein
-
ubiquitin carboxyl-terminal hydrolase 14
-
ubiquitin-activating enzyme E1 isoform 2
-
ubiquitin-conjugating enzyme E2 L3
-
ubiquitin-conjugating enzyme E2D 3
-
UDP-N-acteylglucosamine pyrophosphorylase 1-like 1
-
UPF0568 protein C14orf166 homolog
-
valosin containing protein
-
vesicle amine transport protein 1 homolog (T californica)
-
vimentin
-
vitronectin precursor
-
Substrate Specificity -- Under development
-
Inhibitors -- Under development
-
Pathways -- Under development
Recent News and Literature
We currently do not have custom news for this protein.
Structural Features
MEARVAWGALAGPLRVLCVLCCLLGRAIAAPSPIIKFPGDVAPKTDKELAVQYLNTFYGCPKESCNLFVLKDTLKKMQKF
FGLPQTGDLDQNTIETMRKPRCGNPDVANYNFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARALKVWSDVTPLRFS
RIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFN
GREYSSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNADGQPCKFPFRFQGTSYNSCTTEGRTDGYRWCGTT
EDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKYESCTSAGRNDGKVWCATTTNYDDDRKWGFCPDQGYSLFLV
AAHEFGHAMGLEHSQDPGALMAPIYTYTKNFRLSHDDIKGIQELYGPSPDADTDTGTGPTPTLGPVTPEICKQDIVFDGI
AQIRGEIFFFKDRFIWRTVTPRDKPTGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEYWVYSASTLERGYPKPLTS
LGLPPDVQQVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDPGFPKLIADSWNAIPDNLDAVVDLQGGGHSYFFKGAYYL
KLENQSLKSVKFGSIKSDWLGC
Cross annotation in other databases
matrix metallopeptidase-2 in:
Gene Cards
- Diseases
- Expression
- SNP
- Drugs
Other Links
- Human Protein Atlas
- iHOP
- GNF Sym Atlas
- NCBI Homologs
- OMIM
- MEROPS
Functional Attributes in Pathways
-
Substrates : 339 entries in CutDB for M10.003
Ext
- Insulin-like growth factor-binding protein 6 precursor
- secreted phosphoprotein 1 isoform a
- secreted phosphoprotein 1 isoform b
- 3110003A17Rik protein
- acetyl-Coenzyme A acetyltransferase 2
- Adrenomedulin
- Aggrecan 1 isoform 2 precursor
- alanyl-tRNA synthetase
- aldo-keto reductase family 1, member B1
- aldolase C, fructose-bisphosphate
- Alpha-2-macroglobulin precursor
- alpha-actinin-1
- amyloid beta A4 protein precursor, isoform a
- amyloid-like protein 2
- angiopoietin-related protein 2
- antioxidant protein 1
- APEX nuclease 1
- basophilic leukemia expressed protein BLES03
- beta-galactoside-binding lectin precursor
- biglycan
- bisphosphoglycerate mutase 1
- BolA-2 protein
- Brevican core protein precursor
- calcitonin-related polypeptide, beta
- calpain 2
- calponin 3, acidic
- capping protein (actin filament), gelsolin-like
- Cartilage linking protein 1
- cartilage linking protein 1
- cathepsin A isoform a
- cathepsin A isoform b
- cathepsin L1
- chemokine (C-C motif) ligand 7 precursor
- chemokine (C-X-C motif) ligand 12 (stromal cell-derived factor 1) isoform alpha
- chemokine (C-X-C motif) ligand 12 (stromal cell-derived factor 1) isoform beta
- chemokine (C-X-C motif) ligand 5
- chemokine (C-X3-C motif) ligand 1
- chondroitin sulfate proteoglycan 2 (versican)
- chromobox homolog 5
- cofilin 1, non-muscle
- collagen type III alpha 1 preproprotein
- collagen, type I, alpha 1
- collagen, type I, alpha 2
- collagen, type II, alpha 1 isoform 1 precursor
- collagen, type II, alpha 1 isoform 2 precursor
- collagen, type VI, alpha 1
- complement component 1, q subcomponent, A chain
- complement component 1, q subcomponent, B chain
- complement component 1, q subcomponent, C chain
- complement component 3
- connective tissue growth factor
- cystatin C precursor
- cystatin E/M
- cysteinyl-tRNA synthetase
- cytosol aminopeptidase
- decorin isoform a preproprotein
- decorin isoform b precursor
- decorin isoform c precursor
- delta-aminolevulinic acid dehydratase
- dentin sialophosphoprotein preproprotein
- dermatopontin
- desmoglein 3 preproprotein
- dihydropyrimidinase-like 3 isoform 1
- dihydropyrimidinase-like 3 isoform 2
- dystroglycan 1 precursor
- endothelin 1
- enolase 2, gamma neuronal
- ephrin receptor EphB1 precursor
- ErbB3-binding protein 1
- eukaryotic translation elongation factor 1 gamma
- eukaryotic translation elongation factor 2
- eukaryotic translation initiation factor 1
- eukaryotic translation initiation factor 5A2
- exportin 1, CRM1 homolog
- extracellular matrix protein 1
- far upstream element (FUSE) binding protein 1
- fast myosin alkali light chain 1f
- fast myosin alkali light chain 3f
- fatty acid binding protein 5, epidermal
- fibrillin 1 precursor
- fibrillin 2 precursor
- fibroblast growth factor receptor 1 isoform 1 precursor
- fibronectin 1
- filamin B, beta
- filamin C, gamma
- filamin-A
- FK506 binding protein 52
- follistatin-like 1 precursor
- follistatin-related protein 1
- fructose-bisphosphate aldolase A
- Galectin 3
- gelsolin
- glucosamine-6-phosphate deaminase 1
- glucose phosphate isomerase 1
- glyceraldehyde-3-phosphate dehydrogenase
- glypican 1
- Golli-mbp isoform 1
- Golli-mbp isoform 2
- granulin
- growth arrest-specific protein 1
- guanine nucleotide binding protein (G protein), beta polypeptide 2 like 1
- guanosine diphosphate (GDP) dissociation inhibitor 2
- heat shock 105kD
- heat shock protein 4
- heat shock protein 8
- heat shock protein 90kDa alpha (cytosolic), class A member 1 isoform 1
- heat shock protein 90kDa alpha (cytosolic), class A member 1 isoform 2
- heterogeneous nuclear ribonucleoprotein D isoform a
- heterogeneous nuclear ribonucleoprotein D isoform b
- heterogeneous nuclear ribonucleoprotein D isoform c
- heterogeneous nuclear ribonucleoprotein D isoform d
- heterogeneous nuclear ribonucleoprotein F
- histocompatibility 2, D region locus 1
- HLA-B-associated transcript 1A
- Hsc70-interacting protein
- immunoglobulin light chain, lambda gene cluster
- inositol (myo)-1(or 4)-monophosphatase 1
- insulin-like growth factor binding protein 1 isoform a precursor
- Insulin-like growth factor binding protein 3 isoform b precursor
- insulin-like growth factor binding protein 4
- insulin-like growth factor binding protein 5
- insulin-like growth factor binding protein 6
- insulin-like growth factor binding protein 7 isoform 1
- insulin-like growth factor binding protein 7 isoform 2
- intercellular adhesion molecule 5 precursor
- Interleukin 1, beta proprotein
- karyopherin (importin) alpha 3
- karyopherin beta 1
- Kiss-1 metastasis-suppressor
- L-lactate dehydrogenase A chain
- L-lactate dehydrogenase B
- lamin A isoform A
- laminin, alpha 1 precursor
- laminin, gamma 2
- latent transforming growth factor beta binding protein 1 isoform LTBP-1L
- latent transforming growth factor beta binding protein 1 isoform LTBP-1S
- LIM domain and actin-binding protein 1
- Lupus La protein homolog
- malate dehydrogenase, mitochondrial
- mannose binding lectin 1, protein A
- matrix metalloproteinase 13 preproprotein
- matrix metalloproteinase 2
- matrix metalloproteinase 2 preproprotein
- matrix metalloproteinase 9 preproprotein
- matrix metalloproteinase-11
- Metastasis-suppressor KiSS-1 precursor
- methionine aminopeptidase 2
- moesin
- Myelin basic protein
- myelin basic protein isoform 1
- myelin basic protein isoform 2
- myelin basic protein isoform 3
- myelin basic protein isoform 4
- NAD(P)H dehydrogenase, quinone 1
- nidogen-1
- nucleolin
- nucleoside diphosphate kinase B
- osteoglycin
- pancreatic trypsin inhibitor
- Parkinson disease protein 7
- periostin
- phosphoglycerate dehydrogenase
- phosphoglycerate kinase 1
- phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoimidazole succinocarboxamide synthetase
- plasminogen activator, urokinase
- platelet-derived growth factor receptor-like protein
- pleiotrophin
- poly(A) binding protein, cytoplasmic 1
- poly(rC) binding protein 1
- Pregnancy-zone protein
- procollagen C-proteinase enhancer protein
- procollagen, type IV, alpha 2 preproprotein
- profilin 1
- prolactin
- prolactin family 2, subfamily c, member 3
- prolyl endopeptidase
- proteasome (prosome, macropain) subunit, alpha type 1
- proteasome (prosome, macropain) subunit, alpha type 3
- proteasome (prosome, macropain) subunit, beta type 1
- protein phosphatase 1, catalytic subunit, gamma isoform
- purine-nucleoside phosphorylase 1
- pyruvate kinase, muscle
- RAN binding protein 1
- Rho GDP dissociation inhibitor (GDI) alpha
- ribonuclease/angiogenin inhibitor 1
- ribosomal protein S12
- ribosomal protein S4, X-linked
- ribosomal protein S5
- S-formylglutathione hydrolase
- S100 calcium binding protein A11 (calizzarin)
- secreted phosphoprotein 1 isoform c
- secreted protein, acidic, cysteine-rich (osteonectin)
- serum albumin
- Serum amyloid a2
- soluble mannose-binding lectin precursor
- synaptotagmin binding, cytoplasmic RNA interacting protein isoform 1
- synaptotagmin binding, cytoplasmic RNA interacting protein isoform 2
- tenascin C (hexabrachion)
- thioredoxin 1
- thrombospondin 2
- thymic stromal lymphopoietin
- transferrin
- transforming growth factor, beta 1
- transglutaminase 2 isoform a
- triosephosphate isomerase 1
- tropomyosin 1, alpha
- tubulin, alpha 4
- tubulin, beta 4
- twinfilin-like protein
- ubiquitin carboxyl-terminal hydrolase 14
- ubiquitin-activating enzyme E1 isoform 2
- ubiquitin-conjugating enzyme E2 L3
- ubiquitin-conjugating enzyme E2D 3
- UDP-N-acteylglucosamine pyrophosphorylase 1-like 1
- UPF0568 protein C14orf166 homolog
- valosin containing protein
- vesicle amine transport protein 1 homolog (T californica)
- vimentin
- vitronectin precursor
- Substrate Specificity -- Under development
- Inhibitors -- Under development
- Pathways -- Under development
Recent News and Literature
Structural Features
MEARVAWGALAGPLRVLCVLCCLLGRAIAAPSPIIKFPGDVAPKTDKELAVQYLNTFYGCPKESCNLFVLKDTLKKMQKF
FGLPQTGDLDQNTIETMRKPRCGNPDVANYNFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARALKVWSDVTPLRFS
RIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFN
GREYSSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNADGQPCKFPFRFQGTSYNSCTTEGRTDGYRWCGTT
EDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKYESCTSAGRNDGKVWCATTTNYDDDRKWGFCPDQGYSLFLV
AAHEFGHAMGLEHSQDPGALMAPIYTYTKNFRLSHDDIKGIQELYGPSPDADTDTGTGPTPTLGPVTPEICKQDIVFDGI
AQIRGEIFFFKDRFIWRTVTPRDKPTGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEYWVYSASTLERGYPKPLTS
LGLPPDVQQVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDPGFPKLIADSWNAIPDNLDAVVDLQGGGHSYFFKGAYYL
KLENQSLKSVKFGSIKSDWLGC
Cross annotation in other databases
matrix metallopeptidase-2 in:
- Gene Cards
- Diseases
- Expression
- SNP
- Drugs
- Other Links
- Human Protein Atlas
- iHOP
- GNF Sym Atlas
- NCBI Homologs
- OMIM
- MEROPS

