MMP11

Functional Attributes in Pathways

Recent News and Literature

  1. Cancer cells, adipocytes and matrix...Biol Chem. 2008 Aug;389(8):1037-41.
  2. Expression of the metalloproteases...World J Surg Oncol. 2008 Oct 27;6(1):114.
  3. Comedo-ductal carcinoma in situ:...Cancer Biol Ther. 2008 Nov 12;7(11).
  4. Correlation of Matrix Metalloproteinases...Neuroendocrinology. 2008 Aug 18.
  5. Cancer cells, adipocytes and matrix...Biol Chem. 2008 Aug 8.
  6. New pathway links from...J Cell Physiol. 2008 Jul 23.
  7. Matrix metalloproteinase-11/stromelysin-3 exhibits collagenolytic...Oncogene. 2008 Jul 14;.
  8. Additional MDA-MB-231 breast cancer...J Cell Physiol. 2008 Aug;216(2):480-5.
  9. Role of Immunohistochemical Overexpression...Am J Clin Pathol. 2008 Feb;129(2):226-31.
  10. Identification of matrix metalloproteinase...Clin Cancer Res. 2008 Jan 1;14(1):74-81.
  11. Expression of matrix metalloproteinases...Neurosci Res. 2008 Jan;60(1):40-9. Epub 2007 Sep 29.
  12. CD147 depletion down-regulates matrix...Int J Biochem Cell Biol. 2007;39(11):2135-42. Epub 2007 Jun 28.
  13. siRNA targeted against matrix...Int J Biochem Cell Biol. 2007;39(11):2049-62. Epub 2007 Jun 12.
  14. [Prognostic impact of matrix...Cas Lek Cesk. 2007;146(1):45-7.
  15. [Roles of serine proteases...Bull Mem Acad R Med Belg. 2006;161(5):320-6.
  16. Induction of multiple matrix...Arthritis Res Ther. 2006;8(6):R176.
  17. Identification of carboxypeptidase of glutamate...Clin Cancer Res. 2006 Nov 15;12(22):6617-25.
  18. Inverse relationships between the expression...Pathology. 2006 Oct;38(5):421-5.
  19. [Proteases by reactive stromal...Bull Cancer. 2006 Sep 1;93(9):944-8.
  20. Oxytocin induces proliferation and migration...Mol Cancer Res. 2006 Jun;4(6):351-9.

Structural Features

Structure has not yet been determined for this protein.



Click here to view a 3D model

[-] Domain Structure

Homologs

Sequence

MAPAAWLRSAAARALLPPMLLLLLQPPPLLARALPPDVHHLHAERRGPQPWHAALPSSPAPAPATQEAPRPASSLRPPRC

GVPDPSDGLSARNRQKRFVLSGGRWEKTDLTYRILRFPWQLVQEQVRQTMAEALKVWSDVTPLTFTEVHEGRADIMIDFA

RYWDGDDLPFDGPGGILAHAFFPKTHREGDVHFDYDETWTIGDDQGTDLLQVAAHEFGHVLGLQHTTAAKALMSAFYTFR

YPLSLSPDDCRGVQHLYGQPWPTVTSRTPALGPQAGIDTNEIAPLEPDAPPDACEASFDAVSTIRGELFFFKAGFVWRLR

GGQLQPGYPALASRHWQGLPSPVDAAFEDAQGHIWFFQGAQYWVYDGEKPVLGPAPLTELGLVRFPVHAALVWGPEKNKI

YFFRGRDYWRFHPSTRRVDSPVPRRATDWRGVPSEIDAAFQDADGYAYFLRGRLYWKFDPVKVKALEGFPRLVGPDFFGC

AEPANTFL

Cross annotation in other databases

MMP11 in: