MMP10

Functional Attributes in Pathways

Recent News and Literature

  1. No Association of MMP-7,...Cancer Epidemiol Biomarkers Prev. 2008 Sep;17(9):2514-8.
  2. Matrix metalloproteinase expression and outcome...Ann Oncol. 2008 Sep;19(9):1566-72. Epub 2008 May 23.
  3. Signal-dependent regulation of transcription...Mol Biol Cell. 2008 Jul;19(7):3020-7. Epub 2008 May 7.
  4. Matrix metalloproteinase-10 is a critical...Oncogene. 2008 Apr 21;.
  5. Proto-oncogene ACTR/AIB1 promotes cancer...Cancer Lett. 2008 Mar 8;261(1):64-73. Epub 2007 Dec 26.
  6. Differential expression of stromal...Virchows Arch. 2008 Jan;452(1):83-90. Epub 2007 Nov 22.
  7. Expression of MMP-9, MMP-10...J Cutan Pathol. 2007 Dec;34(12):889-98.
  8. Expression of MMP-10 in lung...Anticancer Res. 2007 Jul-Aug;27(4C):2791-5.
  9. Regulation of extracellular matrix...Cells Tissues Organs. 2007;185(1-3):116-22.
  10. Gene expression profiling in a mouse...Cancer Sci. 2007 Mar;98(3):284-93.
  11. Expression of matrix metalloproteinase-10...Eur Urol. 2007 Sep;52(3):791-7. Epub 2006 Dec 26.
  12. Induction of multiple matrix...Arthritis Res Ther. 2006;8(6):R176.
  13. Induction of matrix metalloproteinase...Cancer Sci. 2007 Jan;98(1):58-67.
  14. Matrix metalloproteinase 10 promotion...Arthritis Rheum. 2006 Oct;54(10):3244-53.
  15. Transformation-specific matrix metalloproteinases, MMP-7...Mod Pathol. 2006 Sep;19(9):1203-12. Epub 2006 May 12.
  16. Regulation of vascular responses...Antioxid Redox Signal. 2006 Mar-Apr;8(3-4):653-60.
  17. Therapeutic implications of the specific...J Pathol. 2006 Jul;209(3):376-83.
  18. Expression of matrix metalloproteinases...Cesk Patol 2006 Jan;42(1): p16-9
  19. Systematic search for gastric...Oncogene 2006 Apr 20;25(17): p2546-57
  20. Metalloproteinases and their inhibitors:...Head Neck. 2006 Jan;28(1):31-9.

Structural Features

[-] Domain Structure

Homologs

Sequence

MMHLAFLVLLCLPVCSAYPLSGAAKEEDSNKDLAQQYLEKYYNLEKDVKQFRRKDSNLIVKKIQGMQKFLGLEVTGKLDT

DTLEVMRKPRCGVPDVGHFSSFPGMPKWRKTHLTYRIVNYTPDLPRDAVDSAIEKALKVWEEVTPLTFSRLYEGEADIMI

SFAVKEHGDFYSFDGPGHSLAHAYPPGPGLYGDIHFDDDEKWTEDASGTNLFLVAAHELGHSLGLFHSANTEALMYPLYN

SFTELAQFRLSQDDVNGIQSLYGPPPASTEEPLVPTKSVPSGSEMPAKCDPALSFDAISTLRGEYLFFKDRYFWRRSHWN

PEPEFHLISAFWPSLPSYLDAAYEVNSRDTVFIFKGNEFWAIRGNEVQAGYPRGIHTLGFPPTIRKIDAAVSDKEKKKTY

FFAADKYWRFDENSQSMEQGFPRLIADDFPGVEPKVDAVLQAFGFFYFFSGSSQFEFDPNARMVTHILKSNSWLHC

Cross annotation in other databases

MMP10 in: