matrix metallopeptidase-3
Functional Attributes in Pathways
-
Substrates : 246 entries in CutDB for M10.005
Ext
-
Aggrecan 1 isoform 2 precursor
-
agrin
-
alpha 1 type II collagen isoform 1
-
alpha 1 type II collagen isoform 2 precursor
-
alpha 1 type XVIII collagen isoform 1 precursor
-
alpha-2-HS-glycoprotei
-
alpha-2-HS-glycoprotein
-
alpha-synuclein isoform NACP140
-
alpha1-antichymotrypsin (Homo sapiens)
-
alpha1-proteinase inhibitor (Homo sapiens)
-
alpha2-antiplasmin (Homo sapiens)
-
alpha2-macroglobulin (Homo sapiens)
-
antithrombin III (Homo sapiens)
-
apolipoprotein A-I preproprotein
-
biglycan preproprotein
-
Brevican core protein precursor
-
cadherin 1
-
Cartilage linking protein 1
-
chemokine (C-C motif) ligand 7 precursor
-
chemokine (C-C motif) ligand 8
-
chondroitin sulfate proteoglycan 2 (versican)
-
clusterin isoform 1
-
clusterin isoform 2
-
collagen alpha1 (II) (Bos taurus)
-
collagen alpha1 (IV) (Bos taurus)
-
collagen type III alpha 1 preproprotein
-
collagen, type II, alpha 1 isoform 1 precursor
-
collagen, type II, alpha 1 isoform 2 precursor
-
collagen, type IX, alpha 3
-
collagenase 2 precursor (Homo sapiens)
-
collagenase 3 precursor (Homo sapiens)
-
complement component 1, q subcomponent, A chain
-
complement component 1, q subcomponent, B chain
-
connective tissue growth factor
-
decorin (Homo sapiens)
-
decorin isoform b precursor
-
decorin isoform c precursor
-
fibrillin 1 precursor
-
fibrinogen, alpha polypeptide isoform alpha preproprotein
-
fibrinogen, alpha polypeptide isoform alpha-E preproprotein
-
fibrinogen, beta chain preproprotein
-
fibrinogen, gamma chain isoform gamma-A precursor
-
fibrinogen, gamma chain isoform gamma-B precursor
-
fibromodulin precursor
-
fibronectin (Homo sapiens)
-
fibronectin 1 isoform 1 preproprotein
-
fibronectin 1 isoform 2 preproprotein
-
fibronectin 1 isoform 3 preproprotein
-
fibronectin 1 isoform 4 preproprotein
-
fibronectin 1 isoform 5 preproprotein
-
fibronectin 1 isoform 6 preproprotein
-
fibronectin 1 isoform 7 preproprotein
-
fibulin-2 (Mus musculus)
-
Gelsolin isoform a precursor
-
gelsolin isoform b
-
heparan sulfate proteoglycan core protein
-
heparin-binding EGF growth factor
-
IgG1 heavy chain (hinge region)
-
IGHG1 protein
-
insulin-like growth factor binding protein 1 isoform a precursor
-
Insulin-like growth factor binding protein 3 isoform b precursor
-
laminin, gamma 2
-
matrilysin precursor (Homo sapiens)
-
matrix metallopeptidase-9
-
matrix metalloproteinase 1 preproprotein
-
matrix metalloproteinase 13 preproprotein
-
matrix metalloproteinase 3 preproprotein
-
matrix metalloproteinase 9 preproprotein
-
Monocyte chemoattractant protein (mcp-3)
-
monocyte chemoattractant protein-1 (Homo sapiens)
-
monocyte chemoattractant protein-2 (Homo sapiens)
-
monocyte chemoattractant protein-3 (Homo sapiens)
-
monocyte chemoattractant protein-4 (Homo sapiens)
-
nidogen (Mus musculus)
-
osteopontin (Homo sapiens)
-
osteopontin (Rattus norvegicus)
-
ovostatin (Gallus gallus)
-
Plasminogen
-
plasminogen (Homo sapiens)
-
Plasminogen activator inhibitor-1
-
plasminogen activator inhibitor-1 (Homo sapiens)
-
Plasminogen activator, urokinase receptor isoform 1 precursor
-
PREDICTED: similar to Collagen alpha-1(XI) chain isoform 1
-
prolactin
-
proline arginine-rich end leucine-rich repeat protein precursor
-
secreted phosphoprotein 1 isoform a
-
secreted protein, acidic, cysteine-rich (osteonectin)
-
selectin L
-
serine (or cysteine) proteinase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1
-
serpin peptidase inhibitor, clade A, member 3 precursor
-
serum amyloid A1 isoform 1
-
Serum amyloid a2
-
similar to alpha 3 type IX collagen
-
similar to Collagen alpha 1(IX) chain precursor, partial
-
similar to Collagen alpha 2(IX) chain precursor
-
skin collagenase precursor
-
Small inducible cytokine a13 precursor
-
Small inducible cytokine a2 precursor
-
Small inducible cytokine a8 precursor
-
stromelysin 1 precursor (Homo sapiens)
-
substance P
-
u-plasminogen activator (Homo sapiens)
-
vascular endothelial growth factor A isoform 2 precursor
-
vascular endothelial growth factor A isoform 5
-
vitronectin precursor
-
Substrate Specificity -- Under development
-
Inhibitors -- Under development
-
Pathways -- Under development
Recent News and Literature
We currently do not have custom news for this protein.
Structural Features
MKGLPVLLWLCVVVCSSYPLHDSARDDDAGMELLQKYLENYYGLAKDVKQFIKKKDSSLIVKKIQEMQKFLGLEMTGKLD
SNTMELMHKPRCGVPDVGGFSTFPGSPKWRKSHITYRIVNYTPDLPRQSVDSAIEKALKVWEEVTPLTFSRISEGEADIM
ISFAVGEHGDFVPFDGPGTVLAHAYAPGPGINGDAHFDDDERWTEDVTGTNLFLVAAHELGHSLGLYHSAKAEALMYPVY
KSSTDLSRFHLSQDDVDGIQSLYGTPTASPDVLVVPTKSNSLEPETSPMCSSTLFFDAVSTLRGEVLFFKDRHFWRKSLR
TPEPEFYLISSFWPSLPSNMDAAYEVTNRDTVFIFKGNQFWAIRGHEELAGYPKSIHTLGLPATVKKIDAAISNKEKRKT
YFFVEDKYWRFDEKKQSMEPGFPRKIAEDFPGVDSRVDAVFEAFGFLYFFSGSSQLEFDPNAKKVTHILKSNSWFNC
Cross annotation in other databases
matrix metallopeptidase-3 in:
Gene Cards
- Diseases
- Expression
- SNP
- Drugs
Other Links
- Human Protein Atlas
- iHOP
- GNF Sym Atlas
- NCBI Homologs
- OMIM
- MEROPS
Functional Attributes in Pathways
-
Substrates : 246 entries in CutDB for M10.005
Ext
- Aggrecan 1 isoform 2 precursor
- agrin
- alpha 1 type II collagen isoform 1
- alpha 1 type II collagen isoform 2 precursor
- alpha 1 type XVIII collagen isoform 1 precursor
- alpha-2-HS-glycoprotei
- alpha-2-HS-glycoprotein
- alpha-synuclein isoform NACP140
- alpha1-antichymotrypsin (Homo sapiens)
- alpha1-proteinase inhibitor (Homo sapiens)
- alpha2-antiplasmin (Homo sapiens)
- alpha2-macroglobulin (Homo sapiens)
- antithrombin III (Homo sapiens)
- apolipoprotein A-I preproprotein
- biglycan preproprotein
- Brevican core protein precursor
- cadherin 1
- Cartilage linking protein 1
- chemokine (C-C motif) ligand 7 precursor
- chemokine (C-C motif) ligand 8
- chondroitin sulfate proteoglycan 2 (versican)
- clusterin isoform 1
- clusterin isoform 2
- collagen alpha1 (II) (Bos taurus)
- collagen alpha1 (IV) (Bos taurus)
- collagen type III alpha 1 preproprotein
- collagen, type II, alpha 1 isoform 1 precursor
- collagen, type II, alpha 1 isoform 2 precursor
- collagen, type IX, alpha 3
- collagenase 2 precursor (Homo sapiens)
- collagenase 3 precursor (Homo sapiens)
- complement component 1, q subcomponent, A chain
- complement component 1, q subcomponent, B chain
- connective tissue growth factor
- decorin (Homo sapiens)
- decorin isoform b precursor
- decorin isoform c precursor
- fibrillin 1 precursor
- fibrinogen, alpha polypeptide isoform alpha preproprotein
- fibrinogen, alpha polypeptide isoform alpha-E preproprotein
- fibrinogen, beta chain preproprotein
- fibrinogen, gamma chain isoform gamma-A precursor
- fibrinogen, gamma chain isoform gamma-B precursor
- fibromodulin precursor
- fibronectin (Homo sapiens)
- fibronectin 1 isoform 1 preproprotein
- fibronectin 1 isoform 2 preproprotein
- fibronectin 1 isoform 3 preproprotein
- fibronectin 1 isoform 4 preproprotein
- fibronectin 1 isoform 5 preproprotein
- fibronectin 1 isoform 6 preproprotein
- fibronectin 1 isoform 7 preproprotein
- fibulin-2 (Mus musculus)
- Gelsolin isoform a precursor
- gelsolin isoform b
- heparan sulfate proteoglycan core protein
- heparin-binding EGF growth factor
- IgG1 heavy chain (hinge region)
- IGHG1 protein
- insulin-like growth factor binding protein 1 isoform a precursor
- Insulin-like growth factor binding protein 3 isoform b precursor
- laminin, gamma 2
- matrilysin precursor (Homo sapiens)
- matrix metallopeptidase-9
- matrix metalloproteinase 1 preproprotein
- matrix metalloproteinase 13 preproprotein
- matrix metalloproteinase 3 preproprotein
- matrix metalloproteinase 9 preproprotein
- Monocyte chemoattractant protein (mcp-3)
- monocyte chemoattractant protein-1 (Homo sapiens)
- monocyte chemoattractant protein-2 (Homo sapiens)
- monocyte chemoattractant protein-3 (Homo sapiens)
- monocyte chemoattractant protein-4 (Homo sapiens)
- nidogen (Mus musculus)
- osteopontin (Homo sapiens)
- osteopontin (Rattus norvegicus)
- ovostatin (Gallus gallus)
- Plasminogen
- plasminogen (Homo sapiens)
- Plasminogen activator inhibitor-1
- plasminogen activator inhibitor-1 (Homo sapiens)
- Plasminogen activator, urokinase receptor isoform 1 precursor
- PREDICTED: similar to Collagen alpha-1(XI) chain isoform 1
- prolactin
- proline arginine-rich end leucine-rich repeat protein precursor
- secreted phosphoprotein 1 isoform a
- secreted protein, acidic, cysteine-rich (osteonectin)
- selectin L
- serine (or cysteine) proteinase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1
- serpin peptidase inhibitor, clade A, member 3 precursor
- serum amyloid A1 isoform 1
- Serum amyloid a2
- similar to alpha 3 type IX collagen
- similar to Collagen alpha 1(IX) chain precursor, partial
- similar to Collagen alpha 2(IX) chain precursor
- skin collagenase precursor
- Small inducible cytokine a13 precursor
- Small inducible cytokine a2 precursor
- Small inducible cytokine a8 precursor
- stromelysin 1 precursor (Homo sapiens)
- substance P
- u-plasminogen activator (Homo sapiens)
- vascular endothelial growth factor A isoform 2 precursor
- vascular endothelial growth factor A isoform 5
- vitronectin precursor
- Substrate Specificity -- Under development
- Inhibitors -- Under development
- Pathways -- Under development
Recent News and Literature
Structural Features
MKGLPVLLWLCVVVCSSYPLHDSARDDDAGMELLQKYLENYYGLAKDVKQFIKKKDSSLIVKKIQEMQKFLGLEMTGKLD
SNTMELMHKPRCGVPDVGGFSTFPGSPKWRKSHITYRIVNYTPDLPRQSVDSAIEKALKVWEEVTPLTFSRISEGEADIM
ISFAVGEHGDFVPFDGPGTVLAHAYAPGPGINGDAHFDDDERWTEDVTGTNLFLVAAHELGHSLGLYHSAKAEALMYPVY
KSSTDLSRFHLSQDDVDGIQSLYGTPTASPDVLVVPTKSNSLEPETSPMCSSTLFFDAVSTLRGEVLFFKDRHFWRKSLR
TPEPEFYLISSFWPSLPSNMDAAYEVTNRDTVFIFKGNQFWAIRGHEELAGYPKSIHTLGLPATVKKIDAAISNKEKRKT
YFFVEDKYWRFDEKKQSMEPGFPRKIAEDFPGVDSRVDAVFEAFGFLYFFSGSSQLEFDPNAKKVTHILKSNSWFNC
Cross annotation in other databases
matrix metallopeptidase-3 in:
- Gene Cards
- Diseases
- Expression
- SNP
- Drugs
- Other Links
- Human Protein Atlas
- iHOP
- GNF Sym Atlas
- NCBI Homologs
- OMIM
- MEROPS

