MMP1
Functional Attributes in Pathways
-
Substrates : 46 entries in CutDB for M10.001
Ext
-
Aggrecan 1 isoform 2 precursor
-
alpha 1 type I collagen preproprotein
-
alpha 1 type II collagen isoform 1
-
alpha1-proteinase inhibitor (Homo sapiens)
-
alpha2-macroglobulin (Homo sapiens)
-
Brevican core protein precursor
-
chemokine (C-C motif) ligand 7 precursor
-
chemokine (C-X-C motif) ligand 5
-
chemokine (C-X-C motif) ligand 5 precursor
-
chondroitin sulfate proteoglycan 2 (versican)
-
coagulation factor II receptor precursor
-
Collagen alpha-1(X) chain precursor
-
complement component 1, q subcomponent, A chain
-
connective tissue growth factor
-
desmocollin 3 isoform Dsc3a preproprotein
-
insulin-like growth factor binding protein 2, 36kDa
-
Insulin-like growth factor binding protein 3 isoform b precursor
-
insulin-like growth factor binding protein 5
-
Interleukin 8 precursor
-
interstitial collagenase (Sus scrofa)
-
matrix metalloproteinase 1 preproprotein
-
proinsulin precursor
-
prolactin
-
selectin L
-
serine (or cysteine) proteinase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1
-
serpin peptidase inhibitor, clade A, member 3 precursor
-
Serum amyloid a2
-
Small inducible cytokine a13 precursor
-
small inducible cytokine A2 precursor
-
Small inducible cytokine a2 precursor
-
Syndecan 1 precursor
-
Tissue factor pathway inhibitor (lipoprotein-associated coagulation inhibitor) isoform a
-
vascular endothelial growth factor A isoform 2 precursor
-
vitronectin precursor
-
Substrate Specificity -- Under development
-
Inhibitors -- Under development
-
Pathways -- Under development
Recent News and Literature
- Cordycepin inhibits IL-1{beta}-induced MMP-1...Rheumatology (Oxford). 2009 Jan;48(1):45-48.
- Induction of matrix metalloproteinase-1...Liver Int. 2008 Nov;28(10):1418-1425.
- Matrix metalloproteinase-1 is a crucial...Oncol Rep. 2008 Dec;20(6):1497-1504.
- Matrix Metalloproteinase-1 and Thrombin...Am J Pathol. 2008 Nov 6.
- Expression of the metalloproteases...World J Surg Oncol. 2008 Oct 27;6(1):114.
- CD147, MMP-1, MMP-2 and MMP-9...Oncology. 2008 Oct 14;75(3-4):230-236.
- Ets-1 upregulates HER2-induced MMP-1...Biochem Biophys Res Commun. 2008 Oct 10.
- Discovery of novel hydroxamates...Bioorg Med Chem Lett. 2008 Sep 13.
- Targeting a metalloprotease-PAR1 signaling...Mol Cancer Ther. 2008 Sep;7(9):2746-57.
- TIMP-1 overexpression promotes tumorigenesis...Breast Cancer Res Treat. 2008 Sep 12.
- Bone morphogenetic proteins induce...Eur J Cancer. 2008 Nov;44(16):2526-34. Epub 2008 Sep 4.
- Transcriptional silencing of ETS-1...Cancer Gene Ther. 2008 Sep 5.
- No Association of MMP-7,...Cancer Epidemiol Biomarkers Prev. 2008 Sep;17(9):2514-8.
- Expression profile of metastasis-related...Histol Histopathol. 2008 Oct;23(10):1213-22.
- MMP-13 is over-expressed in renal...Clin Exp Metastasis. 2008 Aug 16.
- Interaction between CD147 and P-glycoprotein...Chemotherapy. 2008;54(4):291-301. Epub 2008 Aug 8.
- Gene polymorphisms related to angiogenesis,...Oral Oncol. 2008 Jul 30.
- Identification of a novel...Int J Cancer. 2008 Oct 15;123(8):1816-23.
- Gene expression analysis of a porcine...Surgery. 2008 Aug;144(2):252-8.
- New pathway links from...J Cell Physiol. 2008 Jul 23.
Structural Features
MHSFPPLLLLLFWGVVSHSFPATLETQEQDVDLVQKYLEKYYNLKNDGRQVEKRRNSGPVVEKLKQMQEFFGLKVTGKPD
AETLKVMKQPRCGVPDVAQFVLTEGNPRWEQTHLTYRIENYTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIM
ISFVRGDHRDNSPFDGPGGNLAHAFQPGPGIGGDAHFDEDERWTNNFREYNLHRVAAHELGHSLGLSHSTDIGALMYPSY
TFSGDVQLAQDDIDGIQAIYGRSQNPVQPIGPQTPKACDSKLTFDAITTIRGEVMFFKDRFYMRTNPFYPEVELNFISVF
WPQLPNGLEAAYEFADRDEVRFFKGNKYWAVQGQNVLHGYPKDIYSSFGFPRTVKHIDAALSEENTGKTYFFVANKYWRY
DEYKRSMDPGYPKMIAHDFPGIGHKVDAVFMKDGFFYFFHGTRQYKFDPKTKRILTLQKANSWFNCRKN
Cross annotation in other databases
MMP1 in:
Gene Cards
- Diseases
- Expression
- SNP
- Drugs
Other Links
- Human Protein Atlas
- iHOP
- GNF Sym Atlas
- NCBI Homologs
- OMIM
- MEROPS
Functional Attributes in Pathways
-
Substrates : 46 entries in CutDB for M10.001
Ext
- Aggrecan 1 isoform 2 precursor
- alpha 1 type I collagen preproprotein
- alpha 1 type II collagen isoform 1
- alpha1-proteinase inhibitor (Homo sapiens)
- alpha2-macroglobulin (Homo sapiens)
- Brevican core protein precursor
- chemokine (C-C motif) ligand 7 precursor
- chemokine (C-X-C motif) ligand 5
- chemokine (C-X-C motif) ligand 5 precursor
- chondroitin sulfate proteoglycan 2 (versican)
- coagulation factor II receptor precursor
- Collagen alpha-1(X) chain precursor
- complement component 1, q subcomponent, A chain
- connective tissue growth factor
- desmocollin 3 isoform Dsc3a preproprotein
- insulin-like growth factor binding protein 2, 36kDa
- Insulin-like growth factor binding protein 3 isoform b precursor
- insulin-like growth factor binding protein 5
- Interleukin 8 precursor
- interstitial collagenase (Sus scrofa)
- matrix metalloproteinase 1 preproprotein
- proinsulin precursor
- prolactin
- selectin L
- serine (or cysteine) proteinase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1
- serpin peptidase inhibitor, clade A, member 3 precursor
- Serum amyloid a2
- Small inducible cytokine a13 precursor
- small inducible cytokine A2 precursor
- Small inducible cytokine a2 precursor
- Syndecan 1 precursor
- Tissue factor pathway inhibitor (lipoprotein-associated coagulation inhibitor) isoform a
- vascular endothelial growth factor A isoform 2 precursor
- vitronectin precursor
- Substrate Specificity -- Under development
- Inhibitors -- Under development
- Pathways -- Under development
Recent News and Literature
- Cordycepin inhibits IL-1{beta}-induced MMP-1...Rheumatology (Oxford). 2009 Jan;48(1):45-48.
- Induction of matrix metalloproteinase-1...Liver Int. 2008 Nov;28(10):1418-1425.
- Matrix metalloproteinase-1 is a crucial...Oncol Rep. 2008 Dec;20(6):1497-1504.
- Matrix Metalloproteinase-1 and Thrombin...Am J Pathol. 2008 Nov 6.
- Expression of the metalloproteases...World J Surg Oncol. 2008 Oct 27;6(1):114.
- CD147, MMP-1, MMP-2 and MMP-9...Oncology. 2008 Oct 14;75(3-4):230-236.
- Ets-1 upregulates HER2-induced MMP-1...Biochem Biophys Res Commun. 2008 Oct 10.
- Discovery of novel hydroxamates...Bioorg Med Chem Lett. 2008 Sep 13.
- Targeting a metalloprotease-PAR1 signaling...Mol Cancer Ther. 2008 Sep;7(9):2746-57.
- TIMP-1 overexpression promotes tumorigenesis...Breast Cancer Res Treat. 2008 Sep 12.
- Bone morphogenetic proteins induce...Eur J Cancer. 2008 Nov;44(16):2526-34. Epub 2008 Sep 4.
- Transcriptional silencing of ETS-1...Cancer Gene Ther. 2008 Sep 5.
- No Association of MMP-7,...Cancer Epidemiol Biomarkers Prev. 2008 Sep;17(9):2514-8.
- Expression profile of metastasis-related...Histol Histopathol. 2008 Oct;23(10):1213-22.
- MMP-13 is over-expressed in renal...Clin Exp Metastasis. 2008 Aug 16.
- Interaction between CD147 and P-glycoprotein...Chemotherapy. 2008;54(4):291-301. Epub 2008 Aug 8.
- Gene polymorphisms related to angiogenesis,...Oral Oncol. 2008 Jul 30.
- Identification of a novel...Int J Cancer. 2008 Oct 15;123(8):1816-23.
- Gene expression analysis of a porcine...Surgery. 2008 Aug;144(2):252-8.
- New pathway links from...J Cell Physiol. 2008 Jul 23.
Structural Features
MHSFPPLLLLLFWGVVSHSFPATLETQEQDVDLVQKYLEKYYNLKNDGRQVEKRRNSGPVVEKLKQMQEFFGLKVTGKPD
AETLKVMKQPRCGVPDVAQFVLTEGNPRWEQTHLTYRIENYTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIM
ISFVRGDHRDNSPFDGPGGNLAHAFQPGPGIGGDAHFDEDERWTNNFREYNLHRVAAHELGHSLGLSHSTDIGALMYPSY
TFSGDVQLAQDDIDGIQAIYGRSQNPVQPIGPQTPKACDSKLTFDAITTIRGEVMFFKDRFYMRTNPFYPEVELNFISVF
WPQLPNGLEAAYEFADRDEVRFFKGNKYWAVQGQNVLHGYPKDIYSSFGFPRTVKHIDAALSEENTGKTYFFVANKYWRY
DEYKRSMDPGYPKMIAHDFPGIGHKVDAVFMKDGFFYFFHGTRQYKFDPKTKRILTLQKANSWFNCRKN
Cross annotation in other databases
MMP1 in:
- Gene Cards
- Diseases
- Expression
- SNP
- Drugs
- Other Links
- Human Protein Atlas
- iHOP
- GNF Sym Atlas
- NCBI Homologs
- OMIM
- MEROPS

