Caspase 8
Functional Attributes in Pathways
-
Substrates : 106 entries in CutDB for C14.009
Ext
-
A-kinase anchor protein 1 precursor
-
amyloid beta A4 protein precursor, isoform b
-
androgen receptor isoform 1
-
androgen receptor isoform 2
-
apoptotic peptidase activating factor 1
-
arachidonate 5-lipoxygenase
-
atrophin-1
-
B-cell receptor-associated protein 31
-
B-cell receptor-associated protein 31 isoform a
-
B-cell receptor-associated protein 31 isoform b
-
baculoviral IAP repeat-containing protein 4
-
basic transcription factor 3
-
BH3 interacting domain death agonist
-
BH3 interacting domain death agonist isoform 2
-
Bh3 interacting domain death agonist isoform 2
-
carboxypeptidase E
-
CASP8 and FADD-like apoptosis regulator; FLIP
-
Caspase 3 preproprotein
-
Caspase 8 isoform a
-
CUX1 protein
-
cytosolic phospholipase A2, group IVA
-
dihydrolipoamide S-acetyltransferase (E2 component of pyruvate dehydrogenase complex)
-
dopey family member 1
-
erbB-2 isoform a
-
erbB-2 isoform b
-
Eukaryotic translation initiation factor 2, subunit 1 alpha, 35kda
-
Eukaryotic translation initiation factor 2-alpha kinase 2
-
evolutionarily related interleukin-1beta converting enzyme; Caspase-13
-
fragile X mental retardation syndrome related protein 2
-
GATA binding protein 1
-
glutamate receptor, ionotropic, AMPA 1
-
golgi associated PDZ and coiled-coil motif containing
-
histone deacetylase 7
-
histone deacetylase 7A isoform a
-
histone deacetylase 7A isoform b
-
histone deacetylase 7A isoform c
-
histone deacetylase 7A isoform d
-
interferon induced with helicase C domain 1
-
matrin 3
-
Microtubule-associated protein tau isoform 1
-
microtubule-associated protein tau isoform 2
-
microtubule-associated protein tau isoform 3
-
microtubule-associated protein tau isoform 4
-
microtubule-associated protein tau isoform 5
-
microtubule-associated protein tau isoform 6
-
mitogen-activated protein kinase kinase kinase 1
-
myocyte enhancer factor 2A isoform 1
-
myocyte enhancer factor 2A isoform 2
-
myocyte enhancer factor 2A isoform 3
-
myocyte enhancer factor 2A isoform 4
-
parkin isoform 1
-
Phosphate cytidylyltransferase 1, choline, alpha isoform
-
phosphatidylinositol-binding clathrin assembly protein isoform 1
-
phosphatidylinositol-binding clathrin assembly protein isoform 2
-
plectin 1 isoform 1
-
plectin 1 isoform 10
-
plectin 1 isoform 11
-
plectin 1 isoform 2
-
plectin 1 isoform 3
-
Plectin 1 isoform 6
-
plectin 1 isoform 6
-
plectin 1 isoform 7
-
plectin 1 isoform 8
-
poly (ADP-ribose) polymerase family, member 2
-
Presenilin 1 isoform i-467
-
Presenilin 2 isoform 1
-
procaspase 7
-
protein kinase C, zeta isoform 1
-
RAS p21 protein activator 1 isoform 1
-
Receptor (tnfrsf)-interacting serine-threonine kinase 1
-
Receptor-interacting serine/threonine-protein kinase 2
-
small nuclear ribonucleoprotein polypeptide F
-
T-cell acute lymphocytic leukemia 1
-
TNF receptor-associated factor 1
-
Tnf receptor-associated factor 1
-
tyrosine 3/tryptophan 5 -monooxygenase activation protein, theta polypeptide
-
v-abl Abelson murine leukemia viral oncogene homolog 1 isoform a
-
v-abl Abelson murine leukemia viral oncogene homolog 1 isoform b
-
Vesicle docking protein p115
-
vesicle docking protein p115
-
Vimentin
-
wee1 tyrosine kinase
-
Substrate Specificity -- Under development
-
Inhibitors -- Under development
-
Pathways -- Under development
Recent News and Literature
- Quercetin sensitizes human hepatoma...J Cell Biochem. 2008 Nov 3.
- Polyporenic acid C induces...Mol Carcinog. 2008 Oct 30.
- FADD and caspase-8 control...Proc Natl Acad Sci U S A. 2008 Oct 22.
- c-FLIP knockdown induces ligand-independent...Biochem Pharmacol. 2008 Sep 17.
- Combined inhibition of FLIP...Oncogene. 2008 Sep 29.
- Simultaneous downregulation of uPAR...Int J Oncol. 2008 Oct;33(4):783-90.
- Inhibition of fatty acid...J Biol Chem. 2008 Sep 16.
- Regulation of Apoptosis and Caspase-8...Cancer Res. 2008 Sep 15;68(18):7352-61.
- Interleukin-8 signaling attenuates TRAIL-...Mol Cancer Ther. 2008 Sep;7(9):2649-61.
- Mitogen-activated protein kinase kinase...Mol Cancer Ther. 2008 Sep;7(9):2633-48.
- Vorinostat and sorafenib increase...Cancer Biol Ther. 2008 Oct 12;7(10).
- Vorinostat and Sorafenib Synergistically...Clin Cancer Res. 2008 Sep 1;14(17):5385-5399.
- Blockade of processing/activation of caspase-3...Biochem Biophys Res Commun. 2008 Aug 28.
- Diallyl trisulfide increases the effectiveness...Mol Cancer Ther. 2008 Aug;7(8):2328-38.
- FLIP-ping out: Death receptor...Cancer Biol Ther. 2008 Aug 1;7(8).
- Clinicopathological Significance of Caspase-8...Oncology. 2008 Aug 21;74(3-4):229-236.
- A tumour suppressor function...Cell Death Differ. 2008 Sep;15(9):1337-8.
- MUC1 oncoprotein blocks death...Cancer Res. 2008 Aug 1;68(15):6136-44.
- Leukocyte Elastase Inhibitor, the precursor...Biochim Biophys Acta. 2008 Jul 8.
- Sanguinarine, a benzophenanthridine alkaloid,...Chemotherapy. 2008;54(4):279-87. Epub 2008 Jul 31.
Structural Features
MDFSRNLYDIGEQLDSEDLASLKFLSLDYIPQRKQEPIKDALMLFQRLQEKRMLEESNLSFLKELLFRINRLDLLITYLN
TRKEEMERELQTPGRAQISAYRVMLYQISEEVSRSELRSFKFLLQEEISKCKLDDDMNLLDIFIEMEKRVILGEGKLDIL
KRVCAQINKSLLKIINDYEEFSKERSSSLEGSPDEFSNGEELCGVMTISDSPREQDSESQTLDKVYQMKSKPRGYCLIIN
NHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVEQIYEILKIYQLMDHSNMDCFICCILSHGDK
GIIYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQKGIPVETDSEEQPYLEMDLSSPQTRYIPDEADFL
LGMATVNNCVSYRNPAEGTWYIQSLCQSLRERCPRGDDILTILTEVNYEVSNKDDKKNMGKQMPQPTFTLRKKLVFPSD
Cross annotation in other databases
Caspase 8 in:
Gene Cards
- Diseases
- Expression
- SNP
- Drugs
Other Links
- Human Protein Atlas
- iHOP
- GNF Sym Atlas
- NCBI Homologs
- OMIM
- MEROPS
Functional Attributes in Pathways
-
Substrates : 106 entries in CutDB for C14.009
Ext
- A-kinase anchor protein 1 precursor
- amyloid beta A4 protein precursor, isoform b
- androgen receptor isoform 1
- androgen receptor isoform 2
- apoptotic peptidase activating factor 1
- arachidonate 5-lipoxygenase
- atrophin-1
- B-cell receptor-associated protein 31
- B-cell receptor-associated protein 31 isoform a
- B-cell receptor-associated protein 31 isoform b
- baculoviral IAP repeat-containing protein 4
- basic transcription factor 3
- BH3 interacting domain death agonist
- BH3 interacting domain death agonist isoform 2
- Bh3 interacting domain death agonist isoform 2
- carboxypeptidase E
- CASP8 and FADD-like apoptosis regulator; FLIP
- Caspase 3 preproprotein
- Caspase 8 isoform a
- CUX1 protein
- cytosolic phospholipase A2, group IVA
- dihydrolipoamide S-acetyltransferase (E2 component of pyruvate dehydrogenase complex)
- dopey family member 1
- erbB-2 isoform a
- erbB-2 isoform b
- Eukaryotic translation initiation factor 2, subunit 1 alpha, 35kda
- Eukaryotic translation initiation factor 2-alpha kinase 2
- evolutionarily related interleukin-1beta converting enzyme; Caspase-13
- fragile X mental retardation syndrome related protein 2
- GATA binding protein 1
- glutamate receptor, ionotropic, AMPA 1
- golgi associated PDZ and coiled-coil motif containing
- histone deacetylase 7
- histone deacetylase 7A isoform a
- histone deacetylase 7A isoform b
- histone deacetylase 7A isoform c
- histone deacetylase 7A isoform d
- interferon induced with helicase C domain 1
- matrin 3
- Microtubule-associated protein tau isoform 1
- microtubule-associated protein tau isoform 2
- microtubule-associated protein tau isoform 3
- microtubule-associated protein tau isoform 4
- microtubule-associated protein tau isoform 5
- microtubule-associated protein tau isoform 6
- mitogen-activated protein kinase kinase kinase 1
- myocyte enhancer factor 2A isoform 1
- myocyte enhancer factor 2A isoform 2
- myocyte enhancer factor 2A isoform 3
- myocyte enhancer factor 2A isoform 4
- parkin isoform 1
- Phosphate cytidylyltransferase 1, choline, alpha isoform
- phosphatidylinositol-binding clathrin assembly protein isoform 1
- phosphatidylinositol-binding clathrin assembly protein isoform 2
- plectin 1 isoform 1
- plectin 1 isoform 10
- plectin 1 isoform 11
- plectin 1 isoform 2
- plectin 1 isoform 3
- Plectin 1 isoform 6
- plectin 1 isoform 6
- plectin 1 isoform 7
- plectin 1 isoform 8
- poly (ADP-ribose) polymerase family, member 2
- Presenilin 1 isoform i-467
- Presenilin 2 isoform 1
- procaspase 7
- protein kinase C, zeta isoform 1
- RAS p21 protein activator 1 isoform 1
- Receptor (tnfrsf)-interacting serine-threonine kinase 1
- Receptor-interacting serine/threonine-protein kinase 2
- small nuclear ribonucleoprotein polypeptide F
- T-cell acute lymphocytic leukemia 1
- TNF receptor-associated factor 1
- Tnf receptor-associated factor 1
- tyrosine 3/tryptophan 5 -monooxygenase activation protein, theta polypeptide
- v-abl Abelson murine leukemia viral oncogene homolog 1 isoform a
- v-abl Abelson murine leukemia viral oncogene homolog 1 isoform b
- Vesicle docking protein p115
- vesicle docking protein p115
- Vimentin
- wee1 tyrosine kinase
- Substrate Specificity -- Under development
- Inhibitors -- Under development
- Pathways -- Under development
Recent News and Literature
- Quercetin sensitizes human hepatoma...J Cell Biochem. 2008 Nov 3.
- Polyporenic acid C induces...Mol Carcinog. 2008 Oct 30.
- FADD and caspase-8 control...Proc Natl Acad Sci U S A. 2008 Oct 22.
- c-FLIP knockdown induces ligand-independent...Biochem Pharmacol. 2008 Sep 17.
- Combined inhibition of FLIP...Oncogene. 2008 Sep 29.
- Simultaneous downregulation of uPAR...Int J Oncol. 2008 Oct;33(4):783-90.
- Inhibition of fatty acid...J Biol Chem. 2008 Sep 16.
- Regulation of Apoptosis and Caspase-8...Cancer Res. 2008 Sep 15;68(18):7352-61.
- Interleukin-8 signaling attenuates TRAIL-...Mol Cancer Ther. 2008 Sep;7(9):2649-61.
- Mitogen-activated protein kinase kinase...Mol Cancer Ther. 2008 Sep;7(9):2633-48.
- Vorinostat and sorafenib increase...Cancer Biol Ther. 2008 Oct 12;7(10).
- Vorinostat and Sorafenib Synergistically...Clin Cancer Res. 2008 Sep 1;14(17):5385-5399.
- Blockade of processing/activation of caspase-3...Biochem Biophys Res Commun. 2008 Aug 28.
- Diallyl trisulfide increases the effectiveness...Mol Cancer Ther. 2008 Aug;7(8):2328-38.
- FLIP-ping out: Death receptor...Cancer Biol Ther. 2008 Aug 1;7(8).
- Clinicopathological Significance of Caspase-8...Oncology. 2008 Aug 21;74(3-4):229-236.
- A tumour suppressor function...Cell Death Differ. 2008 Sep;15(9):1337-8.
- MUC1 oncoprotein blocks death...Cancer Res. 2008 Aug 1;68(15):6136-44.
- Leukocyte Elastase Inhibitor, the precursor...Biochim Biophys Acta. 2008 Jul 8.
- Sanguinarine, a benzophenanthridine alkaloid,...Chemotherapy. 2008;54(4):279-87. Epub 2008 Jul 31.
Structural Features
MDFSRNLYDIGEQLDSEDLASLKFLSLDYIPQRKQEPIKDALMLFQRLQEKRMLEESNLSFLKELLFRINRLDLLITYLN
TRKEEMERELQTPGRAQISAYRVMLYQISEEVSRSELRSFKFLLQEEISKCKLDDDMNLLDIFIEMEKRVILGEGKLDIL
KRVCAQINKSLLKIINDYEEFSKERSSSLEGSPDEFSNGEELCGVMTISDSPREQDSESQTLDKVYQMKSKPRGYCLIIN
NHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVEQIYEILKIYQLMDHSNMDCFICCILSHGDK
GIIYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQKGIPVETDSEEQPYLEMDLSSPQTRYIPDEADFL
LGMATVNNCVSYRNPAEGTWYIQSLCQSLRERCPRGDDILTILTEVNYEVSNKDDKKNMGKQMPQPTFTLRKKLVFPSD
Cross annotation in other databases
Caspase 8 in:
- Gene Cards
- Diseases
- Expression
- SNP
- Drugs
- Other Links
- Human Protein Atlas
- iHOP
- GNF Sym Atlas
- NCBI Homologs
- OMIM
- MEROPS

