Caspase 6
Functional Attributes in Pathways
-
Substrates : 235 entries in CutDB for C14.005
Ext
-
poly (ADP-ribose) polymerase family, member 1
-
tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide
-
14-3-3 epsilon
-
actin, beta
-
actinin, alpha 1
-
actinin, alpha 4
-
Amyloid beta a4 protein precursor, isoform a
-
amyloid beta A4 protein precursor, isoform b
-
amyloid protein precursor (Homo sapiens)
-
annexin 5
-
arachidonate 5-lipoxygenase
-
baculoviral IAP repeat-containing protein 4
-
Capping protein (actin filament) muscle Z-line, alpha 1
-
Caspase 3 preproprotein
-
caspase 6 isoform alpha preproprotein
-
caspase 6 isoform beta
-
caspase 8 isoform A precursor
-
cofilin 1 (non-muscle)
-
CREB binding protein
-
desmin
-
dihydrolipoamide S-acetyltransferase (E2 component of pyruvate dehydrogenase complex)
-
Dna topoisomerase i
-
drebrin 1
-
drebrin 1 isoform a
-
drebrin 1 isoform b
-
emerin
-
erbB-2 isoform a
-
erbB-2 isoform b
-
eukaryotic translation elongation factor 1 gamma
-
Eukaryotic translation initiation factor 2, subunit 1 alpha, 35kda
-
ezrin
-
fatty acid binding protein 7, brain
-
GDP dissociation inhibitor 1
-
glyceraldehyde-3-phosphate dehydrogenase
-
heat shock protein 90kDa alpha (cytosolic), class A member 1 isoform 1
-
heat shock protein 90kDa beta, member 1
-
homeodomain interacting protein kinase 2 isoform 1
-
huntingtin
-
keratin 15
-
Keratin 18
-
lamin A/C isoform 1 precursor
-
lamin A/C isoform 2
-
lamin A/C isoform 3
-
membrane associated guanylate kinase, WW and PDZ domain containing 1 isoform a
-
microphthalmia-associated transcription factor isoform 1
-
Microtubule-associated protein tau isoform 1
-
microtubule-associated protein tau isoform 2
-
microtubule-associated protein tau isoform 3
-
microtubule-associated protein tau isoform 4
-
microtubule-associated protein tau isoform 5
-
microtubule-associated protein tau isoform 6
-
myocyte enhancer factor 2A isoform 1
-
myocyte enhancer factor 2A isoform 2
-
myocyte enhancer factor 2A isoform 3
-
myocyte enhancer factor 2A isoform 4
-
Neural precursor cell expressed, developmentally down-regulated 4 isoform 2
-
neurolysin
-
notch1 preproprotein
-
nucleoprotein [Transmissible gastroenteritis virus]
-
periplakin
-
Phosphate cytidylyltransferase 1, choline, alpha isoform
-
polyprotein
-
presenilin 1 isoform I-463
-
presenilin 1 isoform I-467
-
Presenilin 1 isoform i-467
-
Presenilin 2 isoform 1
-
procaspase-6
-
prolyl endopeptidase
-
protein kinase C, zeta isoform 1
-
protein phosphatase 1, regulatory (inhibitor) subunit 9B
-
protein phosphatase 1, regulatory subunit 9B
-
PTK2 protein tyrosine kinase 2 isoform a
-
PTK2 protein tyrosine kinase 2 isoform b
-
pyrophosphatase 1
-
RAS p21 protein activator 1 isoform 1
-
SET translocation (myeloid leukemia-associated) isoform 1
-
SET translocation (myeloid leukemia-associated) isoform 2
-
Special at-rich sequence binding protein 1
-
spectrin alpha chain, brain (Spectrin, non-erythroid alpha chain) (Alpha-II spectrin) (Fodrin alpha chain)
-
synuclein alpha interacting protein
-
thymopoietin isoform alpha
-
TNF receptor-associated factor 1
-
Tnf receptor-associated factor 1
-
Transcription factor ap-2 alpha isoform a
-
tubulin, alpha 1a
-
tubulin, alpha 3d
-
tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide
-
Ubiquitin conjugation factor E4 B
-
ubiquitination factor E4B isoform 1
-
v-abl Abelson murine leukemia viral oncogene homolog 1 isoform a
-
v-rel reticuloendotheliosis viral oncogene homolog A, nuclear factor of kappa light polypeptide gene enhancer in B-cells 3, p65
-
valosin-containing protein
-
vimentin
-
Vimentin
-
Substrate Specificity -- Under development
-
Inhibitors -- Under development
-
Pathways -- Under development
Recent News and Literature
- Inactivation of the Human...Endocrinology. 2008 Oct 1.
- Japanese encephalitis virus infection...J Gen Virol. 2008 Aug;89(Pt 8):1930-41.
- Resveratrol displays converse dose-related...Cancer Biol Ther. 2008 May 16;7(8).
- Isoprenoid-independent pathway is involved...Oncol Rep. 2007 Nov;18(5):1291-8.
- The role of cordycepin...Cancer Chemother Pharmacol. 2007 May 9;.
- Caspase-3 and caspase-6 in ductal...Histol Histopathol. 2006 Dec;21(12):1321-9.
- Mutational analysis of the CASP6...APMIS. 2006 Sep;114(9):646-50.
- The essential role of the mitochondria-dependent...Cancer J. 2006 Jul-Aug;12(4):257-73.
- In vitro and in vivo...Clin Cancer Res. 2006 Jun 1;12(11 Pt 1):3485-93.
- The antimicrobial peptide, lactoferricin...Int J Cancer. 2006 Aug 1;119(3):493-500.
- Apoptosis-inducing active components from...Food Chem Toxicol. 2006 Aug;44(8):1261-72. Epub 2006 Mar 20.
- Functional proteomics of resveratrol-induced...Proteomics. 2006 Apr;6(8):2386-94.
- A novel dietary triterpene...Cancer Res 2005 Dec 1;65(23): p11203-13
- Shiga toxin 1 induces...Infect Immun 2005 Aug;73(8): p5115-26
- Polyadenylate polymerase modulations in human...Biol Chem 2005 May;386(5): p471-80
- Cell apoptosis induced by a synthetic...Biochem Pharmacol 2005 Jul 1;70(1): p102-12
- [Phorbol 12-myristate 13-acetate inhibits...Ontogenez. 2005 Jan-Feb;36(1):18-25.
- Tumor necrosis factor-(alpha) decreases...Endocrinology 2005 Jun;146(6): p2726-35
- Caveolin-1 inhibits cell detachment-induced...Oncogene. 2005 Feb 17;24(8):1338-47.
- Microarray analysis of gene...Toxicon 2005 Jan;45(1): p81-91
Structural Features
MSSASGLRRGHPAGGEENMTETDAFYKREMFDPAEKYKMDHRRRGIALIFNHERFFWHLTLPERRGTCADRDNLTRRFSD
LGFEVKCFNDLKAEELLLKIHEVSTVSHADADCFVCVFLSHGEGNHIYAYDAKIEIQTLTGLFKGDKCHSLVGKPKIFII
QACRGNQHDVPVIPLDVVDNQTEKLDTNITEVDAASVYTLPAGADFLMCYSVAEGYYSHRETVNGSWYIQDLCEMLGKYG
SSLEFTELLTLVNRKVSQRRVDFCKDPSAIGKKQVPCFASMLTKKLHFFPKSN
Cross annotation in other databases
Caspase 6 in:
Gene Cards
- Diseases
- Expression
- SNP
- Drugs
Other Links
- Human Protein Atlas
- iHOP
- GNF Sym Atlas
- NCBI Homologs
- OMIM
- MEROPS
Functional Attributes in Pathways
-
Substrates : 235 entries in CutDB for C14.005
Ext
- poly (ADP-ribose) polymerase family, member 1
- tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide
- 14-3-3 epsilon
- actin, beta
- actinin, alpha 1
- actinin, alpha 4
- Amyloid beta a4 protein precursor, isoform a
- amyloid beta A4 protein precursor, isoform b
- amyloid protein precursor (Homo sapiens)
- annexin 5
- arachidonate 5-lipoxygenase
- baculoviral IAP repeat-containing protein 4
- Capping protein (actin filament) muscle Z-line, alpha 1
- Caspase 3 preproprotein
- caspase 6 isoform alpha preproprotein
- caspase 6 isoform beta
- caspase 8 isoform A precursor
- cofilin 1 (non-muscle)
- CREB binding protein
- desmin
- dihydrolipoamide S-acetyltransferase (E2 component of pyruvate dehydrogenase complex)
- Dna topoisomerase i
- drebrin 1
- drebrin 1 isoform a
- drebrin 1 isoform b
- emerin
- erbB-2 isoform a
- erbB-2 isoform b
- eukaryotic translation elongation factor 1 gamma
- Eukaryotic translation initiation factor 2, subunit 1 alpha, 35kda
- ezrin
- fatty acid binding protein 7, brain
- GDP dissociation inhibitor 1
- glyceraldehyde-3-phosphate dehydrogenase
- heat shock protein 90kDa alpha (cytosolic), class A member 1 isoform 1
- heat shock protein 90kDa beta, member 1
- homeodomain interacting protein kinase 2 isoform 1
- huntingtin
- keratin 15
- Keratin 18
- lamin A/C isoform 1 precursor
- lamin A/C isoform 2
- lamin A/C isoform 3
- membrane associated guanylate kinase, WW and PDZ domain containing 1 isoform a
- microphthalmia-associated transcription factor isoform 1
- Microtubule-associated protein tau isoform 1
- microtubule-associated protein tau isoform 2
- microtubule-associated protein tau isoform 3
- microtubule-associated protein tau isoform 4
- microtubule-associated protein tau isoform 5
- microtubule-associated protein tau isoform 6
- myocyte enhancer factor 2A isoform 1
- myocyte enhancer factor 2A isoform 2
- myocyte enhancer factor 2A isoform 3
- myocyte enhancer factor 2A isoform 4
- Neural precursor cell expressed, developmentally down-regulated 4 isoform 2
- neurolysin
- notch1 preproprotein
- nucleoprotein [Transmissible gastroenteritis virus]
- periplakin
- Phosphate cytidylyltransferase 1, choline, alpha isoform
- polyprotein
- presenilin 1 isoform I-463
- presenilin 1 isoform I-467
- Presenilin 1 isoform i-467
- Presenilin 2 isoform 1
- procaspase-6
- prolyl endopeptidase
- protein kinase C, zeta isoform 1
- protein phosphatase 1, regulatory (inhibitor) subunit 9B
- protein phosphatase 1, regulatory subunit 9B
- PTK2 protein tyrosine kinase 2 isoform a
- PTK2 protein tyrosine kinase 2 isoform b
- pyrophosphatase 1
- RAS p21 protein activator 1 isoform 1
- SET translocation (myeloid leukemia-associated) isoform 1
- SET translocation (myeloid leukemia-associated) isoform 2
- Special at-rich sequence binding protein 1
- spectrin alpha chain, brain (Spectrin, non-erythroid alpha chain) (Alpha-II spectrin) (Fodrin alpha chain)
- synuclein alpha interacting protein
- thymopoietin isoform alpha
- TNF receptor-associated factor 1
- Tnf receptor-associated factor 1
- Transcription factor ap-2 alpha isoform a
- tubulin, alpha 1a
- tubulin, alpha 3d
- tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide
- Ubiquitin conjugation factor E4 B
- ubiquitination factor E4B isoform 1
- v-abl Abelson murine leukemia viral oncogene homolog 1 isoform a
- v-rel reticuloendotheliosis viral oncogene homolog A, nuclear factor of kappa light polypeptide gene enhancer in B-cells 3, p65
- valosin-containing protein
- vimentin
- Vimentin
- Substrate Specificity -- Under development
- Inhibitors -- Under development
- Pathways -- Under development
Recent News and Literature
- Inactivation of the Human...Endocrinology. 2008 Oct 1.
- Japanese encephalitis virus infection...J Gen Virol. 2008 Aug;89(Pt 8):1930-41.
- Resveratrol displays converse dose-related...Cancer Biol Ther. 2008 May 16;7(8).
- Isoprenoid-independent pathway is involved...Oncol Rep. 2007 Nov;18(5):1291-8.
- The role of cordycepin...Cancer Chemother Pharmacol. 2007 May 9;.
- Caspase-3 and caspase-6 in ductal...Histol Histopathol. 2006 Dec;21(12):1321-9.
- Mutational analysis of the CASP6...APMIS. 2006 Sep;114(9):646-50.
- The essential role of the mitochondria-dependent...Cancer J. 2006 Jul-Aug;12(4):257-73.
- In vitro and in vivo...Clin Cancer Res. 2006 Jun 1;12(11 Pt 1):3485-93.
- The antimicrobial peptide, lactoferricin...Int J Cancer. 2006 Aug 1;119(3):493-500.
- Apoptosis-inducing active components from...Food Chem Toxicol. 2006 Aug;44(8):1261-72. Epub 2006 Mar 20.
- Functional proteomics of resveratrol-induced...Proteomics. 2006 Apr;6(8):2386-94.
- A novel dietary triterpene...Cancer Res 2005 Dec 1;65(23): p11203-13
- Shiga toxin 1 induces...Infect Immun 2005 Aug;73(8): p5115-26
- Polyadenylate polymerase modulations in human...Biol Chem 2005 May;386(5): p471-80
- Cell apoptosis induced by a synthetic...Biochem Pharmacol 2005 Jul 1;70(1): p102-12
- [Phorbol 12-myristate 13-acetate inhibits...Ontogenez. 2005 Jan-Feb;36(1):18-25.
- Tumor necrosis factor-(alpha) decreases...Endocrinology 2005 Jun;146(6): p2726-35
- Caveolin-1 inhibits cell detachment-induced...Oncogene. 2005 Feb 17;24(8):1338-47.
- Microarray analysis of gene...Toxicon 2005 Jan;45(1): p81-91
Structural Features
MSSASGLRRGHPAGGEENMTETDAFYKREMFDPAEKYKMDHRRRGIALIFNHERFFWHLTLPERRGTCADRDNLTRRFSD
LGFEVKCFNDLKAEELLLKIHEVSTVSHADADCFVCVFLSHGEGNHIYAYDAKIEIQTLTGLFKGDKCHSLVGKPKIFII
QACRGNQHDVPVIPLDVVDNQTEKLDTNITEVDAASVYTLPAGADFLMCYSVAEGYYSHRETVNGSWYIQDLCEMLGKYG
SSLEFTELLTLVNRKVSQRRVDFCKDPSAIGKKQVPCFASMLTKKLHFFPKSN
Cross annotation in other databases
Caspase 6 in:
- Gene Cards
- Diseases
- Expression
- SNP
- Drugs
- Other Links
- Human Protein Atlas
- iHOP
- GNF Sym Atlas
- NCBI Homologs
- OMIM
- MEROPS

