Caspase 6

Functional Attributes in Pathways

Recent News and Literature

  1. Inactivation of the Human...Endocrinology. 2008 Oct 1.
  2. Japanese encephalitis virus infection...J Gen Virol. 2008 Aug;89(Pt 8):1930-41.
  3. Resveratrol displays converse dose-related...Cancer Biol Ther. 2008 May 16;7(8).
  4. Isoprenoid-independent pathway is involved...Oncol Rep. 2007 Nov;18(5):1291-8.
  5. The role of cordycepin...Cancer Chemother Pharmacol. 2007 May 9;.
  6. Caspase-3 and caspase-6 in ductal...Histol Histopathol. 2006 Dec;21(12):1321-9.
  7. Mutational analysis of the CASP6...APMIS. 2006 Sep;114(9):646-50.
  8. The essential role of the mitochondria-dependent...Cancer J. 2006 Jul-Aug;12(4):257-73.
  9. In vitro and in vivo...Clin Cancer Res. 2006 Jun 1;12(11 Pt 1):3485-93.
  10. The antimicrobial peptide, lactoferricin...Int J Cancer. 2006 Aug 1;119(3):493-500.
  11. Apoptosis-inducing active components from...Food Chem Toxicol. 2006 Aug;44(8):1261-72. Epub 2006 Mar 20.
  12. Functional proteomics of resveratrol-induced...Proteomics. 2006 Apr;6(8):2386-94.
  13. A novel dietary triterpene...Cancer Res 2005 Dec 1;65(23): p11203-13
  14. Shiga toxin 1 induces...Infect Immun 2005 Aug;73(8): p5115-26
  15. Polyadenylate polymerase modulations in human...Biol Chem 2005 May;386(5): p471-80
  16. Cell apoptosis induced by a synthetic...Biochem Pharmacol 2005 Jul 1;70(1): p102-12
  17. [Phorbol 12-myristate 13-acetate inhibits...Ontogenez. 2005 Jan-Feb;36(1):18-25.
  18. Tumor necrosis factor-(alpha) decreases...Endocrinology 2005 Jun;146(6): p2726-35
  19. Caveolin-1 inhibits cell detachment-induced...Oncogene. 2005 Feb 17;24(8):1338-47.
  20. Microarray analysis of gene...Toxicon 2005 Jan;45(1): p81-91

Structural Features

Structure has not yet been determined for this protein.



Click here to view a 3D model

MSSASGLRRGHPAGGEENMTETDAFYKREMFDPAEKYKMDHRRRGIALIFNHERFFWHLTLPERRGTCADRDNLTRRFSD

LGFEVKCFNDLKAEELLLKIHEVSTVSHADADCFVCVFLSHGEGNHIYAYDAKIEIQTLTGLFKGDKCHSLVGKPKIFII

QACRGNQHDVPVIPLDVVDNQTEKLDTNITEVDAASVYTLPAGADFLMCYSVAEGYYSHRETVNGSWYIQDLCEMLGKYG

SSLEFTELLTLVNRKVSQRRVDFCKDPSAIGKKQVPCFASMLTKKLHFFPKSN

Cross annotation in other databases

Caspase 6 in: