Caspase 7
Functional Attributes in Pathways
-
Substrates : 132 entries in CutDB for C14.004
Ext
-
PC4 and SFRS1 interacting protein 1 isoform 2
-
T-cell acute lymphocytic leukemia 1
-
actin related protein 2/3 complex, subunit 3, 21kDa
-
actin, gamma 1
-
androgen receptor isoform 1
-
apoptosis inhibitor; annihilator
-
apoptotic peptidase activating factor 1 isoform a
-
ataxin 7
-
atrophin-1
-
baculoviral IAP repeat-containing protein 4
-
Bcl-associated death promoter
-
cadherin 1, type 1 preproprotein
-
calnexin
-
calpastatin isoform f
-
cAMP responsive element binding protein 1 isoform B
-
caspase 12
-
Cell division cycle 42 isoform 1
-
CUX1 protein
-
DNA fragmentation factor, 45kDa, alpha polypeptide isoform 1
-
Double-strand-break repair protein rad21 homolog
-
epidermal growth factor receptor isoform a
-
erbB-2 isoform a
-
erbB-2 isoform b
-
Eukaryotic translation initiation factor 2-alpha kinase 2
-
far upstream element-binding protein 1
-
FK506 binding protein 4
-
fructose-bisphosphate aldolase A
-
GATA binding protein 1
-
Gelsolin isoform a
-
Golgi autoantigen, golgin subfamily a, 3
-
golgi autoantigen, golgin subfamily b, macrogolgin 1
-
GRB2-related adaptor protein 2
-
Growth arrest-specific 2
-
keratin 15
-
keratin 17
-
Keratin 18
-
kinectin 1 isoform b
-
lamin B2
-
Mads box transcription enhancer factor 2, polypeptide d (myocyte enhancer factor 2d)
-
Max protein isoform a
-
membrane associated guanylate kinase, WW and PDZ domain containing 1 isoform a
-
microphthalmia-associated transcription factor isoform 1
-
Microtubule-associated protein tau isoform 1
-
microtubule-associated protein tau isoform 2
-
microtubule-associated protein tau isoform 3
-
microtubule-associated protein tau isoform 4
-
microtubule-associated protein tau isoform 5
-
microtubule-associated protein tau isoform 6
-
mitogen-activated protein kinase kinase kinase 1
-
myocyte enhancer factor 2A isoform 1
-
myocyte enhancer factor 2A isoform 2
-
myocyte enhancer factor 2A isoform 3
-
myocyte enhancer factor 2A isoform 4
-
myocyte enhancer factor 2C isoform 1
-
myocyte enhancer factor 2C isoform 2
-
myocyte enhancer factor 2D
-
Neural precursor cell expressed, developmentally down-regulated 4 isoform 2
-
nucleoprotein [Transmissible gastroenteritis virus]
-
nucleoside diphosphate kinase B
-
p21 protein (Cdc42/Rac)-activated kinase 2
-
PC4 and SFRS1 interacting protein 1 isoform 2
-
Pc4 and sfrs1 interacting protein 1 isoform 2
-
peroxiredoxin-2
-
phospholipase C, gamma 1
-
poly (ADP-ribose) polymerase family, member 1
-
Presenilin 1 isoform i-467
-
Presenilin 2 isoform 1
-
procaspase 7
-
prolyl 4-hydroxylase, beta subunit precursor
-
protease (prosome, macropain) 26S subunit, ATPase 1
-
proteasome (prosome, macropain) activator subunit 1
-
proteasome (prosome, macropain) subunit, alpha type, 1
-
proteasome (prosome, macropain) subunit, alpha type, 2
-
Proteasome activator subunit 3 isoform 1
-
proteasome subunit alpha type-6
-
protein disulfide-isomerase
-
protein kinase C, zeta isoform 1
-
prothymosin, alpha isoform 1
-
prothymosin, alpha isoform 2
-
PTK2 protein tyrosine kinase 2 isoform a
-
RAS p21 protein activator 1 isoform 1
-
Ras p21 protein activator 1 isoform 1
-
septin 5
-
Serum response factor (c-fos serum response element-binding transcription factor)
-
spectrin alpha chain, brain (Spectrin, non-erythroid alpha chain) (Alpha-II spectrin) (Fodrin alpha chain)
-
Sterol regulatory element binding protein-2
-
structure specific recognition protein 1
-
syntaxin 5a
-
T-cell acute lymphocytic leukemia 1
-
T-cell receptor zeta chain isoform 1 precursor
-
T-cell receptor zeta chain isoform 2 precursor
-
Tumor necrosis factor receptor 1 precursor
-
tyrosine 3/tryptophan 5 -monooxygenase activation protein, theta polypeptide
-
Ubiquitin conjugation factor E4 B
-
ubiquitination factor E4B isoform 1
-
v-abl Abelson murine leukemia viral oncogene homolog 1 isoform a
-
valosin-containing protein
-
vimentin
-
wee1 tyrosine kinase
-
Substrate Specificity -- Under development
-
Inhibitors -- Under development
-
Pathways -- Under development
Recent News and Literature
- Assessment of Apoptosis by Immunohistochemistry...J Histochem Cytochem. 2008 Nov 24.
- Inactivation of the Human...Endocrinology. 2008 Oct 1.
- Tumor suppressor effect of follistatin-like...Carcinogenesis. 2008 Sep 16.
- Bcl2L12-mediated inhibition of effector...Proc Natl Acad Sci U S A. 2008 Jul 31.
- Matrix metalloproteinase-9 Inhibition Down-Regulates...Clin Cancer Res. 2008 Jun 1;14(11):3617-26.
- Apoptotic Cell Death in TrkA-overexpressing...Mol Cells. 2008 May 20;26(1).
- Differential cleavage of Mst1...Cell Signal. 2008 Jan 11;.
- Inhibition of ERK attenuates...J Cell Mol Med. 2008 Aug;12(4):1265-71. Epub 2008 Feb 8.
- Survivin and Caspase-3 Expression...Appl Immunohistochem Mol Morphol. 2008 Jan 25;.
- Efficacy of sulforaphane is mediated...Eur J Cancer Prev. 2007 Dec;16(6):505-10.
- Plasminogen structural domains exhibit...J Biol Chem. 2007 Nov 9;282(45):32811-20. Epub 2007 Sep 11.
- Induction of apoptosis by immature...Int J Food Sci Nutr. 2007 Feb;58(1):42-53.
- Leukotriene B4 receptor antagonist...Anticancer Drugs. 2007 Jun;18(5):535-41.
- Relationship between subcellular localisation...Br J Cancer. 2007 Mar 26;96(6):944-51. Epub 2007 Feb 27.
- Black tea polyphenols restrict...Asian Pac J Cancer Prev. 2006 Oct-Dec;7(4):661-6.
- Targeted inhibition of the extracellular...Mol Cancer Ther. 2007 Jan;6(1):138-46.
- Antitumor activity of novel...Clin Cancer Res. 2007 Jan 1;13(1):253-9.
- 5-FdUrd-araC heterodinucleoside re-establishes sensitivity...Differentiation. 2006 Dec;74(9-10):488-98.
- [Study on apoptosis of oral...Ai Zheng. 2006 Aug;25(8):933-40.
- Caspase-mediated cleavage of ATM during...Am J Physiol Renal Physiol. 2006 Dec;291(6):F1300-7. Epub 2006 Jul 18.
Structural Features
MADDQGCIEEQGVEDSANEDSVDAKPDRSSFVPSLFSKKKKNVTMRSIKTTRDRVPTYQYNMNFEKLGKCIIINNKNFDK
VTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQDLLKKASEEDHTNAACFACILLSHGEENVIYGKDGVTPIK
DLTAHFRGDRCKTLLEKPKLFFIQACRGTELDDGIQADSGPINDTDANPRYKIPVEADFLFAYSTVPGYYSWRSPGRGSW
FVQALCSILEEHGKDLEIMQILTRVNDRVARHFESQSDDPHFHEKKQIPCVVSMLTKELYFSQ
Cross annotation in other databases
Caspase 7 in:
Gene Cards
- Diseases
- Expression
- SNP
- Drugs
Other Links
- Human Protein Atlas
- iHOP
- GNF Sym Atlas
- NCBI Homologs
- OMIM
- MEROPS
Functional Attributes in Pathways
-
Substrates : 132 entries in CutDB for C14.004
Ext
- PC4 and SFRS1 interacting protein 1 isoform 2
- T-cell acute lymphocytic leukemia 1
- actin related protein 2/3 complex, subunit 3, 21kDa
- actin, gamma 1
- androgen receptor isoform 1
- apoptosis inhibitor; annihilator
- apoptotic peptidase activating factor 1 isoform a
- ataxin 7
- atrophin-1
- baculoviral IAP repeat-containing protein 4
- Bcl-associated death promoter
- cadherin 1, type 1 preproprotein
- calnexin
- calpastatin isoform f
- cAMP responsive element binding protein 1 isoform B
- caspase 12
- Cell division cycle 42 isoform 1
- CUX1 protein
- DNA fragmentation factor, 45kDa, alpha polypeptide isoform 1
- Double-strand-break repair protein rad21 homolog
- epidermal growth factor receptor isoform a
- erbB-2 isoform a
- erbB-2 isoform b
- Eukaryotic translation initiation factor 2-alpha kinase 2
- far upstream element-binding protein 1
- FK506 binding protein 4
- fructose-bisphosphate aldolase A
- GATA binding protein 1
- Gelsolin isoform a
- Golgi autoantigen, golgin subfamily a, 3
- golgi autoantigen, golgin subfamily b, macrogolgin 1
- GRB2-related adaptor protein 2
- Growth arrest-specific 2
- keratin 15
- keratin 17
- Keratin 18
- kinectin 1 isoform b
- lamin B2
- Mads box transcription enhancer factor 2, polypeptide d (myocyte enhancer factor 2d)
- Max protein isoform a
- membrane associated guanylate kinase, WW and PDZ domain containing 1 isoform a
- microphthalmia-associated transcription factor isoform 1
- Microtubule-associated protein tau isoform 1
- microtubule-associated protein tau isoform 2
- microtubule-associated protein tau isoform 3
- microtubule-associated protein tau isoform 4
- microtubule-associated protein tau isoform 5
- microtubule-associated protein tau isoform 6
- mitogen-activated protein kinase kinase kinase 1
- myocyte enhancer factor 2A isoform 1
- myocyte enhancer factor 2A isoform 2
- myocyte enhancer factor 2A isoform 3
- myocyte enhancer factor 2A isoform 4
- myocyte enhancer factor 2C isoform 1
- myocyte enhancer factor 2C isoform 2
- myocyte enhancer factor 2D
- Neural precursor cell expressed, developmentally down-regulated 4 isoform 2
- nucleoprotein [Transmissible gastroenteritis virus]
- nucleoside diphosphate kinase B
- p21 protein (Cdc42/Rac)-activated kinase 2
- PC4 and SFRS1 interacting protein 1 isoform 2
- Pc4 and sfrs1 interacting protein 1 isoform 2
- peroxiredoxin-2
- phospholipase C, gamma 1
- poly (ADP-ribose) polymerase family, member 1
- Presenilin 1 isoform i-467
- Presenilin 2 isoform 1
- procaspase 7
- prolyl 4-hydroxylase, beta subunit precursor
- protease (prosome, macropain) 26S subunit, ATPase 1
- proteasome (prosome, macropain) activator subunit 1
- proteasome (prosome, macropain) subunit, alpha type, 1
- proteasome (prosome, macropain) subunit, alpha type, 2
- Proteasome activator subunit 3 isoform 1
- proteasome subunit alpha type-6
- protein disulfide-isomerase
- protein kinase C, zeta isoform 1
- prothymosin, alpha isoform 1
- prothymosin, alpha isoform 2
- PTK2 protein tyrosine kinase 2 isoform a
- RAS p21 protein activator 1 isoform 1
- Ras p21 protein activator 1 isoform 1
- septin 5
- Serum response factor (c-fos serum response element-binding transcription factor)
- spectrin alpha chain, brain (Spectrin, non-erythroid alpha chain) (Alpha-II spectrin) (Fodrin alpha chain)
- Sterol regulatory element binding protein-2
- structure specific recognition protein 1
- syntaxin 5a
- T-cell acute lymphocytic leukemia 1
- T-cell receptor zeta chain isoform 1 precursor
- T-cell receptor zeta chain isoform 2 precursor
- Tumor necrosis factor receptor 1 precursor
- tyrosine 3/tryptophan 5 -monooxygenase activation protein, theta polypeptide
- Ubiquitin conjugation factor E4 B
- ubiquitination factor E4B isoform 1
- v-abl Abelson murine leukemia viral oncogene homolog 1 isoform a
- valosin-containing protein
- vimentin
- wee1 tyrosine kinase
- Substrate Specificity -- Under development
- Inhibitors -- Under development
- Pathways -- Under development
Recent News and Literature
- Assessment of Apoptosis by Immunohistochemistry...J Histochem Cytochem. 2008 Nov 24.
- Inactivation of the Human...Endocrinology. 2008 Oct 1.
- Tumor suppressor effect of follistatin-like...Carcinogenesis. 2008 Sep 16.
- Bcl2L12-mediated inhibition of effector...Proc Natl Acad Sci U S A. 2008 Jul 31.
- Matrix metalloproteinase-9 Inhibition Down-Regulates...Clin Cancer Res. 2008 Jun 1;14(11):3617-26.
- Apoptotic Cell Death in TrkA-overexpressing...Mol Cells. 2008 May 20;26(1).
- Differential cleavage of Mst1...Cell Signal. 2008 Jan 11;.
- Inhibition of ERK attenuates...J Cell Mol Med. 2008 Aug;12(4):1265-71. Epub 2008 Feb 8.
- Survivin and Caspase-3 Expression...Appl Immunohistochem Mol Morphol. 2008 Jan 25;.
- Efficacy of sulforaphane is mediated...Eur J Cancer Prev. 2007 Dec;16(6):505-10.
- Plasminogen structural domains exhibit...J Biol Chem. 2007 Nov 9;282(45):32811-20. Epub 2007 Sep 11.
- Induction of apoptosis by immature...Int J Food Sci Nutr. 2007 Feb;58(1):42-53.
- Leukotriene B4 receptor antagonist...Anticancer Drugs. 2007 Jun;18(5):535-41.
- Relationship between subcellular localisation...Br J Cancer. 2007 Mar 26;96(6):944-51. Epub 2007 Feb 27.
- Black tea polyphenols restrict...Asian Pac J Cancer Prev. 2006 Oct-Dec;7(4):661-6.
- Targeted inhibition of the extracellular...Mol Cancer Ther. 2007 Jan;6(1):138-46.
- Antitumor activity of novel...Clin Cancer Res. 2007 Jan 1;13(1):253-9.
- 5-FdUrd-araC heterodinucleoside re-establishes sensitivity...Differentiation. 2006 Dec;74(9-10):488-98.
- [Study on apoptosis of oral...Ai Zheng. 2006 Aug;25(8):933-40.
- Caspase-mediated cleavage of ATM during...Am J Physiol Renal Physiol. 2006 Dec;291(6):F1300-7. Epub 2006 Jul 18.
Structural Features
MADDQGCIEEQGVEDSANEDSVDAKPDRSSFVPSLFSKKKKNVTMRSIKTTRDRVPTYQYNMNFEKLGKCIIINNKNFDK
VTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQDLLKKASEEDHTNAACFACILLSHGEENVIYGKDGVTPIK
DLTAHFRGDRCKTLLEKPKLFFIQACRGTELDDGIQADSGPINDTDANPRYKIPVEADFLFAYSTVPGYYSWRSPGRGSW
FVQALCSILEEHGKDLEIMQILTRVNDRVARHFESQSDDPHFHEKKQIPCVVSMLTKELYFSQ
Cross annotation in other databases
Caspase 7 in:
- Gene Cards
- Diseases
- Expression
- SNP
- Drugs
- Other Links
- Human Protein Atlas
- iHOP
- GNF Sym Atlas
- NCBI Homologs
- OMIM
- MEROPS

