KLK14
Functional Attributes in Pathways
-
Substrates : 40 entries in CutDB for S01.029
Ext
-
coagulation factor II (thrombin) receptor-like 1 precursor
-
coagulation factor II (thrombin) receptor-like 3
-
coagulation factor II (thrombin) receptor-like 3 precursor
-
coagulation factor II receptor precursor
-
collagen, type I, alpha 1
-
collagen, type I, alpha 2
-
collagen, type IV, alpha 2
-
fibrinogen, alpha polypeptide isoform alpha preproprotein
-
fibrinogen, beta chain preproprotein
-
fibronectin 1 isoform 3 preproprotein
-
insulin-like growth factor binding protein 2
-
insulin-like growth factor binding protein 3 isoform a precursor
-
insulin-like growth factor binding protein 3 isoform b precursor
-
kallikrein 14 preproprotein
-
kallikrein-related peptidase 5 preproprotein
-
kininogen 1 isoform 2
-
laminin, alpha 1 precursor
-
laminin, beta 1 precursor
-
plasminogen
-
vitronectin precursor
-
Substrate Specificity -- Under development
-
Inhibitors -- Under development
-
Pathways -- Under development
Recent News and Literature
- High Expression of KLK14...Tumour Biol. 2008;29(1):1-8. Epub 2008 May 23.
- Expression and enzymatic characterization...Zoolog Sci. 2007 Aug;24(8):774-80.
- Defining the extended substrate...Biol Chem. 2007 Nov;388(11):1215-25.
- Expression and functional characterization...J Biol Chem. 2007 Jan 26;282(4):2405-22. Epub 2006 Nov 16.
- Enzymatic profiling of human...Biol Chem 2005 Mar;386(3): p291-8
- Human kallikrein 14: a...Cancer Res 2003 Dec 15;63(24): p9032-41
- Human tissue kallikreins and...APMIS 2003 Jan;111(1): p225-32; discussion 232-3
- Cloning of a new...Cancer Res 2001 Apr 15;61(8): p3425-31
Structural Features
MFLLLTALQVLAIAMTQSQEDENKIIGGHTCTRSSQPWQAALLAGPRRRFLCGGALLSGQWVITAAHCGRPILQVALGKH
NLRRWEATQQVLRVVRQVTHPNYNSRTHDNDLMLLQLQQPARIGRAVRPIEVTQACASPGTSCRVSGWGTISSPIARYPA
SLQCVNINISPDEVCQKAYPRTITPGMVCAGVPQGGKDSCQGDSGGPLVCRGQLQGLVSWGMERCALPGYPGVYTNLCKY
RSWIEETMRDK
Cross annotation in other databases
KLK14 in:
Gene Cards
- Diseases
- Expression
- SNP
- Drugs
Other Links
- Human Protein Atlas
- iHOP
- GNF Sym Atlas
- NCBI Homologs
- OMIM
- MEROPS
Functional Attributes in Pathways
-
Substrates : 40 entries in CutDB for S01.029
Ext
- coagulation factor II (thrombin) receptor-like 1 precursor
- coagulation factor II (thrombin) receptor-like 3
- coagulation factor II (thrombin) receptor-like 3 precursor
- coagulation factor II receptor precursor
- collagen, type I, alpha 1
- collagen, type I, alpha 2
- collagen, type IV, alpha 2
- fibrinogen, alpha polypeptide isoform alpha preproprotein
- fibrinogen, beta chain preproprotein
- fibronectin 1 isoform 3 preproprotein
- insulin-like growth factor binding protein 2
- insulin-like growth factor binding protein 3 isoform a precursor
- insulin-like growth factor binding protein 3 isoform b precursor
- kallikrein 14 preproprotein
- kallikrein-related peptidase 5 preproprotein
- kininogen 1 isoform 2
- laminin, alpha 1 precursor
- laminin, beta 1 precursor
- plasminogen
- vitronectin precursor
- Substrate Specificity -- Under development
- Inhibitors -- Under development
- Pathways -- Under development
Recent News and Literature
- High Expression of KLK14...Tumour Biol. 2008;29(1):1-8. Epub 2008 May 23.
- Expression and enzymatic characterization...Zoolog Sci. 2007 Aug;24(8):774-80.
- Defining the extended substrate...Biol Chem. 2007 Nov;388(11):1215-25.
- Expression and functional characterization...J Biol Chem. 2007 Jan 26;282(4):2405-22. Epub 2006 Nov 16.
- Enzymatic profiling of human...Biol Chem 2005 Mar;386(3): p291-8
- Human kallikrein 14: a...Cancer Res 2003 Dec 15;63(24): p9032-41
- Human tissue kallikreins and...APMIS 2003 Jan;111(1): p225-32; discussion 232-3
- Cloning of a new...Cancer Res 2001 Apr 15;61(8): p3425-31
Structural Features
MFLLLTALQVLAIAMTQSQEDENKIIGGHTCTRSSQPWQAALLAGPRRRFLCGGALLSGQWVITAAHCGRPILQVALGKH
NLRRWEATQQVLRVVRQVTHPNYNSRTHDNDLMLLQLQQPARIGRAVRPIEVTQACASPGTSCRVSGWGTISSPIARYPA
SLQCVNINISPDEVCQKAYPRTITPGMVCAGVPQGGKDSCQGDSGGPLVCRGQLQGLVSWGMERCALPGYPGVYTNLCKY
RSWIEETMRDK
Cross annotation in other databases
KLK14 in:
- Gene Cards
- Diseases
- Expression
- SNP
- Drugs
- Other Links
- Human Protein Atlas
- iHOP
- GNF Sym Atlas
- NCBI Homologs
- OMIM
- MEROPS
© The PMAP Web Site is managed by The Center on Proteolytic Pathways at the Burnham Institute for Medical Research through a grant from the NIH Roadmap.
Copyright 2008. All rights reserved.
The Burnham Institute for Medical Research 10901 N. Torrey Pines Rd., La Jolla, CA 92037.
With problems, comments, or suggestions please contact: pmap_info@burnham.org