Caspase 10
Functional Attributes in Pathways
-
Substrates : 12 entries in CutDB for C14.011
Ext
-
A-kinase anchor protein 1 precursor
-
ATP-binding cassette, sub-family F (GCN20), member 1
-
Bcl-associated death promoter
-
Bh3 interacting domain death agonist isoform 2
-
Caspase 10 isoform d preproprotein
-
Caspase 3 preproprotein
-
caspase 7 isoform alpha precursor
-
CUX1 protein
-
Eukaryotic translation initiation factor 2, subunit 1 alpha, 35kda
-
golgi associated PDZ and coiled-coil motif containing
-
insulin receptor substrate 1
-
insulin receptor substrate 2
-
Substrate Specificity -- Under development
-
Inhibitors -- Under development
-
Pathways -- Under development
Recent News and Literature
- Clinicopathological Significance of Caspase-8...Oncology. 2008 Aug 21;74(3-4):229-236.
- Genetic variants and haplotypes...Hum Mutat. 2008 Jun 18;.
- Matrix metalloproteinase-9 Inhibition Down-Regulates...Clin Cancer Res. 2008 Jun 1;14(11):3617-26.
- The important role of caspase-10...Kobe J Med Sci. 2007;53(5):265-73.
- The Amaryllidaceae isocarbostyril narciclasine...Neoplasia. 2007 Sep;9(9):766-76.
- Apaf-1 and caspase-9 deficiency...Blood. 2007 Nov 15;110(10):3662-72. Epub 2007 Jul 25.
- HDAC inhibitors induce apoptosis...Int J Biochem Cell Biol. 2007 Mar 15;.
- Blockade of death receptor-mediated...J Invest Dermatol. 2007 Oct;127(10):2425-37. Epub 2007 May 10.
- Caspase-10 involvement in cytotoxic...Oncogene. 2006 Dec 7;25(58):7635-45. Epub 2006 Jun 12.
- In vitro and in vivo...Clin Cancer Res. 2006 Jun 1;12(11 Pt 1):3485-93.
- Bis(2-hydroxybenzylidene)acetone, a potent inducer...Cancer Lett. 2007 Jan 8;245(1-2):341-9. Epub 2006 Mar 6.
- Bovine herpesvirus 4 induces...Cancer Res. 2005 Oct 15;65(20):9463-72.
- Taxol induces caspase-10-dependent apoptosis....J Biol Chem 2004 Dec 3;279(49): p51057-67
- E-Cadherin (CDH1) and p53 rather...Eur J Cancer. 2004 Aug;40(12):1897-903.
- Caspase-mediated Cleavage of Insulin...J Biol Chem 2004 Jun 11;279(24): p25149-56
- Lactacystin, a proteasome inhibitor,...Anticancer Res 2002 Nov-Dec;22(6C): p3805-9
- Profiling of differentially expressed...World J Gastroenterol. 2002 Aug;8(4):580-5.
- Inactivating mutations of CASP10...Blood 2002 Jun 1;99(11): p4094-9
- Caspase-10 is an initiator...Proc Natl Acad Sci U S A. 2001 Nov 20;98(24):13884-8.
- Death receptor recruitment of endogenous...J Biol Chem 2001 Dec 7;276(49): p46639-46
Structural Features
MKSQGQHWYSSSDKNCKVSFREKLLIIDSNLGVQDVENLKFLCIGLVPNKKLEKSSSASDVFEHLLAEDLLSEEDPFFLA
ELLYIIRQKKLLQHLNCTKEEVERLLPTRQRVSLFRNLLYELSEGIDSENLKDMIFLLKDSLPKTEMTSLSFLAFLEKQG
KIDEDNLTCLEDLCKTVVPKLLRNIEKYKREKAIQIVTPPVDKEAESYQGEEELVSQTDVKTFLEALPQESWQNKHAGSN
GNRATNGAPSLVSRGMQGASANTLNSETSTKRAAVYRMNRNHRGLCVIVNNHSFTSLKDRQGTHKDAEILSHVFQWLGFT
VHIHNNVTKVEMEMVLQKQKCNPAHADGDCFVFCILTHGRFGAVYSSDEALIPIREIMSHFTALQCPRLAEKPKLFFIQA
CQGEEIQPSVSIEADALNPEQAPTSLQDSIPAEADFLLGLATVPGYVSFRHVEEGSWYIQSLCNHLKKLVPRMLKFLEKT
MEIRGRKRTVWGAKQISATSLPTAISAQTPRPPMRRWSSVS
Cross annotation in other databases
Caspase 10 in:
Gene Cards
- Diseases
- Expression
- SNP
- Drugs
Other Links
- Human Protein Atlas
- iHOP
- GNF Sym Atlas
- NCBI Homologs
- OMIM
- MEROPS
Functional Attributes in Pathways
-
Substrates : 12 entries in CutDB for C14.011
Ext
- A-kinase anchor protein 1 precursor
- ATP-binding cassette, sub-family F (GCN20), member 1
- Bcl-associated death promoter
- Bh3 interacting domain death agonist isoform 2
- Caspase 10 isoform d preproprotein
- Caspase 3 preproprotein
- caspase 7 isoform alpha precursor
- CUX1 protein
- Eukaryotic translation initiation factor 2, subunit 1 alpha, 35kda
- golgi associated PDZ and coiled-coil motif containing
- insulin receptor substrate 1
- insulin receptor substrate 2
- Substrate Specificity -- Under development
- Inhibitors -- Under development
- Pathways -- Under development
Recent News and Literature
- Clinicopathological Significance of Caspase-8...Oncology. 2008 Aug 21;74(3-4):229-236.
- Genetic variants and haplotypes...Hum Mutat. 2008 Jun 18;.
- Matrix metalloproteinase-9 Inhibition Down-Regulates...Clin Cancer Res. 2008 Jun 1;14(11):3617-26.
- The important role of caspase-10...Kobe J Med Sci. 2007;53(5):265-73.
- The Amaryllidaceae isocarbostyril narciclasine...Neoplasia. 2007 Sep;9(9):766-76.
- Apaf-1 and caspase-9 deficiency...Blood. 2007 Nov 15;110(10):3662-72. Epub 2007 Jul 25.
- HDAC inhibitors induce apoptosis...Int J Biochem Cell Biol. 2007 Mar 15;.
- Blockade of death receptor-mediated...J Invest Dermatol. 2007 Oct;127(10):2425-37. Epub 2007 May 10.
- Caspase-10 involvement in cytotoxic...Oncogene. 2006 Dec 7;25(58):7635-45. Epub 2006 Jun 12.
- In vitro and in vivo...Clin Cancer Res. 2006 Jun 1;12(11 Pt 1):3485-93.
- Bis(2-hydroxybenzylidene)acetone, a potent inducer...Cancer Lett. 2007 Jan 8;245(1-2):341-9. Epub 2006 Mar 6.
- Bovine herpesvirus 4 induces...Cancer Res. 2005 Oct 15;65(20):9463-72.
- Taxol induces caspase-10-dependent apoptosis....J Biol Chem 2004 Dec 3;279(49): p51057-67
- E-Cadherin (CDH1) and p53 rather...Eur J Cancer. 2004 Aug;40(12):1897-903.
- Caspase-mediated Cleavage of Insulin...J Biol Chem 2004 Jun 11;279(24): p25149-56
- Lactacystin, a proteasome inhibitor,...Anticancer Res 2002 Nov-Dec;22(6C): p3805-9
- Profiling of differentially expressed...World J Gastroenterol. 2002 Aug;8(4):580-5.
- Inactivating mutations of CASP10...Blood 2002 Jun 1;99(11): p4094-9
- Caspase-10 is an initiator...Proc Natl Acad Sci U S A. 2001 Nov 20;98(24):13884-8.
- Death receptor recruitment of endogenous...J Biol Chem 2001 Dec 7;276(49): p46639-46
Structural Features
MKSQGQHWYSSSDKNCKVSFREKLLIIDSNLGVQDVENLKFLCIGLVPNKKLEKSSSASDVFEHLLAEDLLSEEDPFFLA
ELLYIIRQKKLLQHLNCTKEEVERLLPTRQRVSLFRNLLYELSEGIDSENLKDMIFLLKDSLPKTEMTSLSFLAFLEKQG
KIDEDNLTCLEDLCKTVVPKLLRNIEKYKREKAIQIVTPPVDKEAESYQGEEELVSQTDVKTFLEALPQESWQNKHAGSN
GNRATNGAPSLVSRGMQGASANTLNSETSTKRAAVYRMNRNHRGLCVIVNNHSFTSLKDRQGTHKDAEILSHVFQWLGFT
VHIHNNVTKVEMEMVLQKQKCNPAHADGDCFVFCILTHGRFGAVYSSDEALIPIREIMSHFTALQCPRLAEKPKLFFIQA
CQGEEIQPSVSIEADALNPEQAPTSLQDSIPAEADFLLGLATVPGYVSFRHVEEGSWYIQSLCNHLKKLVPRMLKFLEKT
MEIRGRKRTVWGAKQISATSLPTAISAQTPRPPMRRWSSVS
Cross annotation in other databases
Caspase 10 in:
- Gene Cards
- Diseases
- Expression
- SNP
- Drugs
- Other Links
- Human Protein Atlas
- iHOP
- GNF Sym Atlas
- NCBI Homologs
- OMIM
- MEROPS

