MMP16

Functional Attributes in Pathways

Recent News and Literature

  1. MT3-MMP (MMP-16) is downregulated...Connect Tissue Res. 2008;49(2):62-7.
  2. CDC25A inhibition suppresses the growth...Int J Mol Med. 2008 Feb;21(2):145-52.
  3. Overexpression of MT3-MMP in hepatocellular...Hepatogastroenterology. 2007 Jan-Feb;54(73):167-71.
  4. Cell surface chondroitin sulfate...Biochem J. 2007 May 1;403(3):553-63.
  5. beta-Catenin/Wnt signaling regulates expression...Cancer Res. 2006 May 1;66(9):4734-41.
  6. Individual Timp deficiencies differentially...J Biol Chem. 2006 Apr 14;281(15):10337-46. Epub 2006 Feb 9.
  7. Expression of matrix metalloproteinases...Oncol Rep 2005 Jun;13(6): p1043-8
  8. Genistein suppresses the invasive...Int J Oncol. 2005 Apr;26(4):1101-9.
  9. Correlation of tumor- and stromal-derived...Gynecol Oncol 2004 Dec;95(3): p437-48
  10. Upregulation of matrix metalloproteinases...Int J Cancer 2005 Apr 20;114(4): p544-54
  11. Expression of mRNA for membrane-type...Chin Med Sci J 2004 Sep;19(3): p170-3
  12. Crystal structure of the catalytic...J Mol Biol 2004 Feb 6;336(1): p213-25
  13. Co-recycling of MT1-MMP and MT3-MMP...J Biol Chem 2004 Mar 5;279(10): p9331-6
  14. Cytokine-regulated expression of collagenase-2...Eur J Cancer. 2003 Nov;39(17):2499-505.
  15. Testican 2 abrogates inhibition...Cancer Res 2003 Jun 15;63(12): p3364-9
  16. mRNA expression of the five...Prostate 2003 May 1;55(2): p89-98
  17. Increased expression of membrane...Circulation 2002 Dec 10;106(24): p3024-30
  18. Profiling of differentially expressed...World J Gastroenterol. 2002 Aug;8(4):580-5.
  19. Relationship between expression of matrix...Eur J Cell Biol 2002 Jul;81(7): p383-9
  20. Endothelial tubulogenesis within fibrin...J Cell Sci 2002 Sep 1;115(Pt 17): p3427-38

Structural Features

[-] Domain Structure

Homologs

Sequence

MILLTFSTGRRLDFVHHSGVFFLQTLLWILCATVCGTEQYFNVEVWLQKYGYLPPTDPRMSVLRSAETMQSALAAMQQFY

GINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFHIRRKRYALTGQKWQHKHITYSIKNVTPKVGDPETRKAIRRAFDVWQ

NVTPLTFEEVPYSELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDL

FLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYGPPDKIPPPTRPLPTVPPHRSIPPADPRKN

DRPKPPRPPTGRPSYPGAKPNICDGNFNTLAILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENSD

GNFVFFKGNKYWVFKDTTLQPGYPHDLITLGSGIPPHGIDSAIWWEDVGKTYFFKGDRYWRYSEEMKTMDPGYPKPITVW

KGIPESPQGAFVHKENGFTYFYKGKEYWKFNNQILKVEPGYPRSILKDFMGCDGPTDRVKEGHSPPDDVDIVIKLDNTAS

TVKAIAIVIPCILALCLLVLVYTVFQFKRKGTPRHILYCKRSMQEWV

Cross annotation in other databases

MMP16 in: