MMP15

Functional Attributes in Pathways

Recent News and Literature

  1. Imatinib inhibits colorectal cancer...Int J Cancer. 2007 Dec 15;121(12):2808-14.
  2. Gonadotropin-releasing hormone analogues alter...Anticancer Res. 2006 Nov-Dec;26(6B):4615-21.
  3. Profiling markers of prognosis...Clin Cancer Res 2006 Feb 15;12(4): p1184-91
  4. Individual Timp deficiencies differentially...J Biol Chem. 2006 Apr 14;281(15):10337-46. Epub 2006 Feb 9.
  5. PACE4 expression in mouse...Cancer Res 2005 Aug 15;65(16): p7310-9
  6. Upregulated MT1-MMP/TIMP-2 axis in the TSU-Pr1-B1/B2...Clin Exp Metastasis 2005;22(2): p115-25
  7. The chemokine stromal cell...Carcinogenesis 2005 Dec;26(12): p2069-77
  8. Expression of matrix metalloproteinases...Oncol Rep 2005 Jun;13(6): p1043-8
  9. Expression of MMPs and TIMPs...Anticancer Res. 2004 Nov-Dec;24(6):4025-30.
  10. Matrix metalloproteinase/tissue inhibitors of matrix...Clin Cancer Res 2004 Dec 15;10(24): p8229-34
  11. Correlation of tumor- and stromal-derived...Gynecol Oncol 2004 Dec;95(3): p437-48
  12. Upregulation of matrix metalloproteinases...Int J Cancer 2005 Apr 20;114(4): p544-54
  13. Differences between scirrhous and non-scirrhous...Clin Exp Metastasis 2004;21(3): p223-33
  14. Expression of matrix metalloproteinases...Clin Cancer Res. 2004 Jul 15;10(14):4746-53.
  15. A study on angiogenesis-related...J Exp Clin Cancer Res 2003 Sep;22(3): p461-70
  16. Proteases in brain tumour...Acta Neurochir (Wien 2003 Sep;145(9): p825-38
  17. Endothelial tubulogenesis within fibrin...J Cell Sci 2002 Sep 1;115(Pt 17): p3427-38
  18. Malignant conversion of non-tumorigenic...Carcinogenesis 2002 Apr;23(4): p565-72
  19. Immunohistochemical study of membrane...J Dermatol Sci 2002 Feb;28(2): p119-25
  20. Expression of membrane-type 1, 2, and 3 matrix...Am J Clin Pathol 2001 Apr;115(4): p517-24

Structural Features

Structure has not yet been determined for this protein.



Click here to view a 3D model

[-] Domain Structure

Homologs

Sequence

MGSDPSAPGRPGWTGSLLGDREEAARPRLLPLLLVLLGCLGLGVAAEDAEVHAENWLRLYGYLPQPSRHMSTMRSAQILA

SALAEMQRFYGIPVTGVLDEETKEWMKRPRCGVPDQFGVRVKANLRRRRKRYALTGRKWNNHHLTFSIQNYTEKLGWYHS

MEAVRRAFRVWEQATPLVFQEVPYEDIRLRRQKEADIMVLFASGFHGDSSPFDGTGGFLAHAYFPGPGLGGDTHFDADEP

WTFSSTDLHGNNLFLVAVHELGHALGLEHSSNPNAIMAPFYQWKDVDNFKLPEDDLRGIQQLYGTPDGQPQPTQPLPTVT

PRRPGRPDHRPPRPPQPPPPGGKPERPPKPGPPVQPRATERPDQYGPNICDGDFDTVAMLRGEMFVFKGRWFWRVRHNRV

LDNYPMPIGHFWRGLPGDISAAYERQDGRFVFFKGDRYWLFREANLEPGYPQPLTSYGLGIPYDRIDTAIWWEPTGHTFF

FQEDRYWRFNEETQRGDPGYPKPISVWQGIPASPKGAFLSNDAAYTYFYKGTKYWKFDNERLRMEPGYPKSILRDFMGCQ

EHVEPGPRWPDVARPPFNPHGGAEPGADSAEGDVGDGDGDFGAGVNKDGGSRVVVQMEEVARTVNVVMVLVPLLLLLCVL

GLTYALVQMQRKGAPRVLLYCKRSLQEWV

Cross annotation in other databases

MMP15 in: