cathepsin E

Functional Attributes in Pathways

Recent News and Literature

  1. A novel cell penetrating...Biochem Biophys Res Commun. 2007 Dec 14;364(2):243-9. Epub 2007 Oct 4.
  2. Regulation of the human...Arch Biochem Biophys. 2007 Nov 1;467(1):132-8. Epub 2007 Aug 19.
  3. Cathepsin E is a specific...Tumour Biol. 2006;27(1):36-42. Epub 2005 Dec 8.
  4. Gene expression profiling of progressive...Clin Cancer Res. 2005 Jun 15;11(12):4415-29.
  5. Modeling the tertiary structure...Biochem Biophys Res Commun 2005 May 27;331(1): p56-60
  6. The absence of p53 promotes...Mol Cell Biol. 2005 Feb;25(4):1228-37.
  7. Protein expression profiles in adenocarcinomas...J Pathol. 2004 Jul;203(3):798-807.
  8. New functional aspects of cathepsin...Mol Cells (Korea 2000 Dec 31;10(6): p601-11
  9. Conversion of cathepsin E to enzymatic...Biol Pharm Bull 1995 Nov;18(11): p1522-5
  10. Cathepsin E expressed in pancreatic...Adv Exp Med Biol 1995;362:363-6
  11. Cervical adenocarcinomas express markers...Pathol Res Pract 1994 Apr;190(4): p342-9
  12. Purification and properties of cathepsin...Biol Chem Hoppe Seyler 1988 May;369 Suppl:323-7

Structural Features

[-] Domain Structure

Homologs

Sequence

MKTLLLLLLVLLELGEAQGSLHRVPLRRHPSLKKKLRARSQLSEFWKSHNLDMIQFTESCSMDQSAKEPLINYLDMEYFG

TISIGSPPQNFTVIFDTGSSNLWVPSVYCTSPACKTHSRFQPSQSSTYSQPGQSFSIQYGTGSLSGIIGADQVSVEGLTV

VGQQFGESVTEPGQTFVDAEFDGILGLGYPSLAVGGVTPVFDNMMAQNLVDLPMFSVYMSSNPEGGAGSELIFGGYDHSH

FSGSLNWVPVTKQAYWQIALDNIQVGGTVMFCSEGCQAIVDTGTSLITGPSDKIKQLQNAIGAAPVDGEYAVECANLNVM

PDVTFTINGVPYTLSPTAYTLLDFVDGMQFCSSGFQGLDIHPPAGPLWILGDVFIRQFYSVFDRGNNRVGLAPAVP

Cross annotation in other databases

cathepsin E in: