Renin

Functional Attributes in Pathways

Recent News and Literature

  1. Does the renin-angiotensin system...Cancer Res. 2008 Nov 15;68(22):9112-5.
  2. Polymorphisms of matrix metalloproteinase-7...J Gastroenterol. 2008;43(10):751-61. Epub 2008 Oct 29.
  3. Role of the renin-angiotensin...Mol Cell Endocrinol. 2008 Sep 7.
  4. Hypertension Due to a Renin-Secreting...Am J Hypertens. 2008 Sep 18.
  5. Favorable response to combination...Int J Urol. 2008 Sep;15(9):848-850.
  6. Combination therapy with Renin-Angiotensin...Hypertens Res. 2008 Jun;31(6):1147-55.
  7. Ectopic expression of serotonin...Endocr Relat Cancer. 2008 Aug 15.
  8. The renin-angiotensin system and malignancy....Carcinogenesis. 2008 Jul 16;.
  9. Wilms' tumor protein (-KTS)...Kidney Int. 2008 May 21;.
  10. Newly developed hypertension as an early...Int J Urol. 2008 Jun;15(6):540-2.
  11. Angiotensin II type 1 receptor...Dig Dis Sci. 2008 Jan;53(1):163-8. Epub 2007 May 8.
  12. Derivation and characterization of three...Reprod Biomed Online. 2006 Dec;13(6):875-86.
  13. Adaptation of renal function...Ren Fail. 2006;28(7):527-35.
  14. Altered levels of acid,...Am J Physiol Renal Physiol. 2007 Feb;292(2):F780-8. Epub 2006 Sep 19.
  15. The role of angiotensin...Endocr Relat Cancer. 2006 Sep;13(3):895-903.
  16. Inhibitors of cathepsin B....Curr Med Chem. 2006;13(19):2309-27.
  17. Localisation of renin-angiotensin system...Br J Cancer. 2006 Jul 3;95(1):67-74. Epub 2006 Jun 6.
  18. Insulin-regulated aminopeptidase/placental leucil Aminopeptidase...Anticancer Res 2006 Mar-Apr;26(2A): p1011-4
  19. Genotoxicity of advanced glycation...Ann N Y Acad Sci 2005 Jun;1043:685-95
  20. Midkine, a newly discovered...Biochem Biophys Res Commun. 2005 Jul 29;333(2):636-43.

Structural Features

[-] Domain Structure

Homologs

Sequence

MDGWRRMPRWGLLLLLWGSCTFGLPTDTTTFKRIFLKRMPSIRESLKERGVDMARLGPEWSQPMKRLTLGNTTSSVILTN

YMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRLYTACVYHKLFDASDSSSYKHNGTELTLRYSTGTVSGFLSQ

DIITVGGITVTQMFGEVTEMPALPFMLAEFDGVVGMGFIEQAIGRVTPIFDNIISQGVLKEDVFSFYYNRDSENSQSLGG

QIVLGGSDPQHYEGNFHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYISGSTSSIEKLMEALGAKKRLFD

YVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRI

GFALAR

Cross annotation in other databases

Renin in: