Pepsinogen C

Functional Attributes in Pathways

Recent News and Literature

  1. Overall Survival in Women...DNA Cell Biol. 2008 Apr 30;.
  2. [Correlation between an insertion-deletion...Zhonghua Yi Xue Za Zhi. 2006 Nov 21;86(43):3059-63.
  3. Gastric cancer in a Caucasian...World J Gastroenterol. 2006 Aug 21;12(31):5033-6.
  4. Immunohistochemical study of pepsinogen...Int J Biol Markers 2001 Oct-Dec;16(4): p240-4
  5. Fast detection of phosphorylation...J Chromatogr B Biomed Sci Appl. 1997 Jan 24;688(2):213-20.
  6. Hormonal regulation of the human...J Biol Chem 1996 Jun 21;271(25): p15175-81
  7. Expression of pepsinogen C in human...Br J Cancer 1993 Sep;68(3): p637-40
  8. Pepsinogen C is a new prognostic...J Clin Oncol 1995 Jan;13(1): p54-61
  9. Gastricsin in the benign...J Clin Pathol 1985 Jun;38(6): p639-43
  10. [Pepsinogen C in the human...Rozhl Chir 1989 Feb;68(2): p122-7

Structural Features

[-] Domain Structure

Homologs

Sequence

MKWMVVVLVCLQLLEAAVVKVPLKKFKSIRETMKEKGLLGEFLRTHKYDPAWKYRFGDLSVTYEPMAYMDAAYFGEISIG

TPPQNFLVLFDTGSSNLWVPSVYCQSQACTSHSRFNPSESSTYSTNGQTFSLQYGSGSLTGFFGYDTLTVQSIQVPNQEF

GLSENEPGTNFVYAQFDGIMGLAYPALSVDEATTAMQGMVQEGALTSPVFSVYLSNQQGSSGGAVVFGGVDSSLYTGQIY

WAPVTQELYWQIGIEEFLIGGQASGWCSEGCQAIVDTGTSLLTVPQQYMSALLQATGAQEDEYGQFLVNCNSIQNLPSLT

FIINGVEFPLPPSSYILSNNGYCTVGVEPTYLSSQNGQPLWILGDVFLRSYYSVYDLGNNRVGFATAA

Cross annotation in other databases

Pepsinogen C in: