Caspase 1
Functional Attributes in Pathways
-
Substrates : 81 entries in CutDB for C14.001
Ext
-
60 kDa heat shock protein, mitochondrial
-
Actin, cytoplasmic 2
-
Activating signal cointegrator 1 complex subunit 2
-
Amyloid beta A4 precursor protein-binding family B member 1-interacting protein
-
androgen receptor isoform 1
-
ARF GTPase-activating protein GIT2
-
ataxin 3 isoform 1
-
ataxin 3 isoform 2
-
atrophin-1
-
B-cell receptor-associated protein 31 isoform a
-
B-cell receptor-associated protein 31 isoform b
-
Bcl2-like 1 isoform 1
-
BCL2-like 1 isoform 2
-
beta actin
-
Bh3 interacting domain death agonist isoform 2
-
calpastatin isoform a
-
Caspase 1 isoform alpha precursor
-
Caspase-7 precursor
-
cell division cycle 2-like 2 isoform 1
-
cell division cycle protein 27
-
cell division cycle protein 27 isoform 1
-
Cyclin G-associated kinase
-
Cytosolic phospholipase A2
-
cytosolic phospholipase A2, group IVA
-
DNA replication licensing factor MCM3
-
E3 ubiquitin-protein ligase HUWE1
-
Endoplasmin
-
epidermal growth factor receptor isoform a
-
Eukaryotic translation initiation factor 4H
-
FYN-binding protein
-
huntingtin
-
interferon-gamma inducing factor precursor (Homo sapiens)
-
interleukin 1 family, member 7 isoform 1 proprotein
-
interleukin 1, beta
-
Interleukin 1, beta proprotein
-
interleukin 1, beta proprotein
-
Interleukin 18 proprotein
-
lamin A/C isoform 2
-
Ligatin
-
Microtubule-associated protein tau isoform 1
-
microtubule-associated protein tau isoform 2
-
microtubule-associated protein tau isoform 3
-
microtubule-associated protein tau isoform 4
-
microtubule-associated protein tau isoform 5
-
microtubule-associated protein tau isoform 6
-
Neural precursor cell expressed, developmentally down-regulated 4 isoform 2
-
parkin isoform 1
-
Periphilin-1
-
Poly (adp-ribose) polymerase family, member 1
-
Presenilin 1 isoform i-467
-
Presenilin 2 isoform 1
-
Protein SMG7
-
small nuclear ribonucleoprotein polypeptide F
-
spectrin alpha chain, brain (Spectrin, non-erythroid alpha chain) (Alpha-II spectrin) (Fodrin alpha chain)
-
Target of Myb protein 1
-
Transcription factor ap-2 alpha isoform a
-
Tyrosine-protein phosphatase non-receptor type 18
-
Vacuolar protein sorting-associated protein 72 homolog
-
Substrate Specificity -- Under development
-
Inhibitors -- Under development
-
Pathways -- Under development
Recent News and Literature
- Mutational analysis of caspase...Hum Pathol. 2008 Apr 18;.
- Crystals of monosodium urate...Ann Rheum Dis. 2008 Apr 4;.
- The CEACAM1-mediated apoptosis pathway...Oncogene. 2008 Feb 18;.
- Inflammatory mediators in Escherichia...Comp Immunol Microbiol Infect Dis. 2008 Feb 1;.
- Critical involvement of pneumolysin...Infect Immun. 2008 Apr;76(4):1547-57. Epub 2008 Jan 14.
- Microarray-based prediction of tumor...Clin Gastroenterol Hepatol. 2008 Jan;6(1):53-61.
- Interferons increase cell resistance...Infect Immun. 2008 Feb;76(2):571-7. Epub 2007 Dec 10.
- Lack of BCL-2 confers...Growth Factors. 2007 Apr;25(2):94-100.
- Tumor necrosis factor-alpha-induced caspase-1...FEBS J. 2007 Sep;274(17):4396-407.
- Insulin and IGF-1 mediated...Altern Lab Anim. 2007 Jun;35(3):349-52.
- Gossypol reduction of tumor...Int J Cancer. 2007 Oct 15;121(8):1670-9.
- Induction of proinflammatory cytokines...J Vet Med Sci. 2007 May;69(5):509-14.
- High plasma levels of CD40...Scand J Clin Lab Invest. 2007;67(2):115-22.
- (S)-1-((S)-2-{[1-(4-amino-3-chloro-phenyl)-methanoyl]-amino}-3,3-dimethyl-butanoy l)-pyrrolidine-2-carboxylic acid ((2R,3S)-2-ethoxy-5-oxo-tetrahydro-furan-3-yl)-amide...J Pharmacol Exp Ther. 2007 May;321(2):509-16. Epub 2007 Feb 8.
- The expression of FHIT,...Br J Cancer. 2007 Jan 15;96(1):110-7. Epub 2006 Dec 12.
- Homeopathic medicines do not alter...Integr Cancer Ther. 2006 Dec;5(4):356-61.
- Effect of homeopathic treatment...Integr Cancer Ther. 2006 Dec;5(4):350-5.
- Recent advances in the molecular...Curr Opin Allergy Clin Immunol. 2006 Dec;6(6):428-33.
- Clinical and experimental approaches...Cancer Metastasis Rev. 2006 Sep;25(3):417-34.
- Amrubicin induces apoptosis in human...Cancer Sci. 2006 Dec;97(12):1396-403. Epub 2006 Sep 21.
Structural Features
MADKVLKEKRKLFIRSMGEGTINGLLDELLQTRVLNKEEMEKVKRENATVMDKTRALIDSVIPKGAQACQICITYICEED
SYLAGTLGLSADQTSGNYLNMQDSQGVLSSFPAPQAVQDNPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSS
RTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIR
EGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKDSVGVSGNLSLPTTEEFEDDAIKK
AHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYL
FPGH
Cross annotation in other databases
Caspase 1 in:
Gene Cards
- Diseases
- Expression
- SNP
- Drugs
Other Links
- Human Protein Atlas
- iHOP
- GNF Sym Atlas
- NCBI Homologs
- OMIM
- MEROPS
Functional Attributes in Pathways
-
Substrates : 81 entries in CutDB for C14.001
Ext
- 60 kDa heat shock protein, mitochondrial
- Actin, cytoplasmic 2
- Activating signal cointegrator 1 complex subunit 2
- Amyloid beta A4 precursor protein-binding family B member 1-interacting protein
- androgen receptor isoform 1
- ARF GTPase-activating protein GIT2
- ataxin 3 isoform 1
- ataxin 3 isoform 2
- atrophin-1
- B-cell receptor-associated protein 31 isoform a
- B-cell receptor-associated protein 31 isoform b
- Bcl2-like 1 isoform 1
- BCL2-like 1 isoform 2
- beta actin
- Bh3 interacting domain death agonist isoform 2
- calpastatin isoform a
- Caspase 1 isoform alpha precursor
- Caspase-7 precursor
- cell division cycle 2-like 2 isoform 1
- cell division cycle protein 27
- cell division cycle protein 27 isoform 1
- Cyclin G-associated kinase
- Cytosolic phospholipase A2
- cytosolic phospholipase A2, group IVA
- DNA replication licensing factor MCM3
- E3 ubiquitin-protein ligase HUWE1
- Endoplasmin
- epidermal growth factor receptor isoform a
- Eukaryotic translation initiation factor 4H
- FYN-binding protein
- huntingtin
- interferon-gamma inducing factor precursor (Homo sapiens)
- interleukin 1 family, member 7 isoform 1 proprotein
- interleukin 1, beta
- Interleukin 1, beta proprotein
- interleukin 1, beta proprotein
- Interleukin 18 proprotein
- lamin A/C isoform 2
- Ligatin
- Microtubule-associated protein tau isoform 1
- microtubule-associated protein tau isoform 2
- microtubule-associated protein tau isoform 3
- microtubule-associated protein tau isoform 4
- microtubule-associated protein tau isoform 5
- microtubule-associated protein tau isoform 6
- Neural precursor cell expressed, developmentally down-regulated 4 isoform 2
- parkin isoform 1
- Periphilin-1
- Poly (adp-ribose) polymerase family, member 1
- Presenilin 1 isoform i-467
- Presenilin 2 isoform 1
- Protein SMG7
- small nuclear ribonucleoprotein polypeptide F
- spectrin alpha chain, brain (Spectrin, non-erythroid alpha chain) (Alpha-II spectrin) (Fodrin alpha chain)
- Target of Myb protein 1
- Transcription factor ap-2 alpha isoform a
- Tyrosine-protein phosphatase non-receptor type 18
- Vacuolar protein sorting-associated protein 72 homolog
- Substrate Specificity -- Under development
- Inhibitors -- Under development
- Pathways -- Under development
Recent News and Literature
- Mutational analysis of caspase...Hum Pathol. 2008 Apr 18;.
- Crystals of monosodium urate...Ann Rheum Dis. 2008 Apr 4;.
- The CEACAM1-mediated apoptosis pathway...Oncogene. 2008 Feb 18;.
- Inflammatory mediators in Escherichia...Comp Immunol Microbiol Infect Dis. 2008 Feb 1;.
- Critical involvement of pneumolysin...Infect Immun. 2008 Apr;76(4):1547-57. Epub 2008 Jan 14.
- Microarray-based prediction of tumor...Clin Gastroenterol Hepatol. 2008 Jan;6(1):53-61.
- Interferons increase cell resistance...Infect Immun. 2008 Feb;76(2):571-7. Epub 2007 Dec 10.
- Lack of BCL-2 confers...Growth Factors. 2007 Apr;25(2):94-100.
- Tumor necrosis factor-alpha-induced caspase-1...FEBS J. 2007 Sep;274(17):4396-407.
- Insulin and IGF-1 mediated...Altern Lab Anim. 2007 Jun;35(3):349-52.
- Gossypol reduction of tumor...Int J Cancer. 2007 Oct 15;121(8):1670-9.
- Induction of proinflammatory cytokines...J Vet Med Sci. 2007 May;69(5):509-14.
- High plasma levels of CD40...Scand J Clin Lab Invest. 2007;67(2):115-22.
- (S)-1-((S)-2-{[1-(4-amino-3-chloro-phenyl)-methanoyl]-amino}-3,3-dimethyl-butanoy l)-pyrrolidine-2-carboxylic acid ((2R,3S)-2-ethoxy-5-oxo-tetrahydro-furan-3-yl)-amide...J Pharmacol Exp Ther. 2007 May;321(2):509-16. Epub 2007 Feb 8.
- The expression of FHIT,...Br J Cancer. 2007 Jan 15;96(1):110-7. Epub 2006 Dec 12.
- Homeopathic medicines do not alter...Integr Cancer Ther. 2006 Dec;5(4):356-61.
- Effect of homeopathic treatment...Integr Cancer Ther. 2006 Dec;5(4):350-5.
- Recent advances in the molecular...Curr Opin Allergy Clin Immunol. 2006 Dec;6(6):428-33.
- Clinical and experimental approaches...Cancer Metastasis Rev. 2006 Sep;25(3):417-34.
- Amrubicin induces apoptosis in human...Cancer Sci. 2006 Dec;97(12):1396-403. Epub 2006 Sep 21.
Structural Features
MADKVLKEKRKLFIRSMGEGTINGLLDELLQTRVLNKEEMEKVKRENATVMDKTRALIDSVIPKGAQACQICITYICEED
SYLAGTLGLSADQTSGNYLNMQDSQGVLSSFPAPQAVQDNPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSS
RTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIR
EGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKDSVGVSGNLSLPTTEEFEDDAIKK
AHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYL
FPGH
Cross annotation in other databases
Caspase 1 in:
- Gene Cards
- Diseases
- Expression
- SNP
- Drugs
- Other Links
- Human Protein Atlas
- iHOP
- GNF Sym Atlas
- NCBI Homologs
- OMIM
- MEROPS

