MMP19

Functional Attributes in Pathways

Recent News and Literature

  1. New pathway links from...J Cell Physiol. 2008 Jul 23.
  2. Chordoma and chondrosarcoma gene...Cancer Immunol Immunother. 2008 Jul 19.
  3. Expression and distribution of MMPs...Exp Eye Res. 2008 Jun;86(6):936-41. Epub 2008 Mar 16.
  4. Erratum in Int J Biol...Int J Biol Markers. 2008 Jan-Mar;23(1):64.
  5. Additional MDA-MB-231 breast cancer...J Cell Physiol. 2008 Aug;216(2):480-5.
  6. Endoglin expression in metastatic...Oncogene. 2008 Jun 5;27(25):3567-75. Epub 2008 Jan 28.
  7. Matrix metalloproteinase-19 is a predictive...Int J Biol Markers. 2007 Oct-Dec;22(4):265-73.
  8. Expression of matrix metalloproteinases...Neurosci Res. 2008 Jan;60(1):40-9. Epub 2007 Sep 29.
  9. Earlier onset of tumoral...Cancer Res. 2006 May 15;66(10):5234-41.
  10. Transformation-specific matrix metalloproteinases, MMP-7...Mod Pathol. 2006 Sep;19(9):1203-12. Epub 2006 May 12.
  11. Matrix metalloproteinase 19 processes...Cell Mol Life Sci 2005 Apr;62(7-8): p870-80
  12. Expression of matrix metalloproteinase...Br J Dermatol 2005 Apr;152(4): p720-6
  13. Activity of MMP-19 inhibits...Cell Mol Life Sci 2004 Jul;61(14): p1826-33
  14. Matrilysin-1 (MMP-7) and MMP-19...J Cutan Pathol 2004 Aug;31(7): p483-91
  15. Differential expression of three...Dig Dis Sci 2004 Apr;49(4): p653-61
  16. Diet-induced obesity and reduced...Mol Cell Biol 2004 Jun;24(12): p5304-13
  17. Threonine 98, the pivotal...J Biol Chem 2004 Apr 23;279(17): p17562-9
  18. Matrix metalloproteinase-19 expression in dermal...J Invest Dermatol 2003 Nov;121(5): p997-1004
  19. Matrix metalloproteinase-19 expression in normal...J Invest Dermatol 2003 Nov;121(5): p989-96
  20. Differential expression of matrilysin-1...J Pathol 2004 Jan;202(1): p14-22

Structural Features

Structure has not yet been determined for this protein.



Click here to view a 3D model

[-] Domain Structure

Homologs

Sequence

MNCQQLWLGFLLPMTVSGRVLGLAEVAPVDYLSQYGYLQKPLEGSNNFKPEDITEALRAFQEASELPVSGQLDDATRARM

RQPRCGLEDPFNQKTLKYLLLGRWRKKHLTFRILNLPSTLPPHTARAALRQAFQDWSNVAPLTFQEVQAGAADIRLSFHG

RQSSYCSNTFDGPGRVLAHADIPELGSVHFDEDEFWTEGTYRGVNLRIIAAHEVGHALGLGHSRYSQALMAPVYEGYRPH

FKLHPDDVAGIQALYGKKSPVIRDEEEEETELPTVPPVPTEPSPMPDPCSSELDAMMLGPRGKTYAFKGDYVWTVSDSGP

GPLFRVSALWEGLPGNLDAAVYSPRTQWIHFFKGDKVWRYINFKMSPGFPKKLNRVEPNLDAALYWPLNQKVFLFKGSGY

WQWDELARTDFSSYPKPIKGLFTGVPNQPSAAMSWQDGRVYFFKGKVYWRLNQQLRVEKGYPRNISHNWMHCRPRTIDTT

PSGGNTTPSGTGITLDTTLSATETTFEY

Cross annotation in other databases

MMP19 in: