cathepsin K

Functional Attributes in Pathways

Recent News and Literature

  1. Increased osteoclast activity is associated...Int J Oncol. 2008 Dec;33(6):1231-8.
  2. The interaction of monocytes...Immunology. 2008 Nov 14.
  3. Lysosomal cathepsin B participates...Cancer Res. 2008 Nov 15;68(22):9147-56.
  4. Epithelial and Stromal Cathepsin...Clin Cancer Res. 2008 Sep 1;14(17):5357-67.
  5. Cathepsin K inhibitors as treatment...Curr Opin Support Palliat Care. 2008 Sep;2(3):218-22.
  6. Cathepsin G enhances mammary...Cancer Res. 2008 Jul 15;68(14):5803-11.
  7. Heparanase regulates retention and proliferation...Blood. 2008 Mar 11;.
  8. Human breast adenocarcinoma (MDA-231)...Clin Exp Metastasis. 2008;25(4):437-44. Epub 2008 Feb 27.
  9. Interactions between microenvironment and cancer...Br J Cancer. 2008 Feb 26;98(4):809-15. Epub 2008 Feb 5.
  10. Cathepsin K deficiency partially...Arthritis Rheum. 2008 Feb;58(2):422-34.
  11. Interactions of myeloma cells...Exp Cell Res. 2008 Mar 10;314(5):1082-93. Epub 2007 Nov 7.
  12. AP-1 stimulates the cathepsin...Gene. 2007 Nov 15;403(1-2):151-8. Epub 2007 Aug 25.
  13. Long-term effects of infliximab...Ann Rheum Dis. 2008 Mar;67(3):353-7. Epub 2007 Jul 20.
  14. Emerging roles of cysteine...Curr Pharm Des. 2007;13(4):387-403.
  15. Osteoclasts: what do they...Am J Pathol. 2007 Feb;170(2):427-35.
  16. Regulation and enzymatic basis...Clin Sci (Lond). 2007 Jun;112(11):567-75.
  17. Use of molecular imaging...Arthritis Rheum. 2007 Jan;56(1):117-28.
  18. High throughput screening identified...Assay Drug Dev Technol. 2006 Aug;4(4):387-96.
  19. Analysis of host- and tumor-derived...Cancer Res. 2006 Aug 15;66(16):7968-75.
  20. Natural biflavones as novel...Eur J Med Chem. 2006 Nov;41(11):1247-52. Epub 2006 Jul 7.

Structural Features

[-] Domain Structure

Homologs

Sequence

MWGLKVLLLPVVSFALYPEEILDTHWELWKKTHRKQYNNKVDEISRRLIWEKNLKYISIHNLEASLGVHTYELAMNHLGD

MTSEEVVQKMTGLKVPLSHSRSNDTLYIPEWEGRAPDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLL

NLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVA

RVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGI

ANLASFPKM

Cross annotation in other databases

cathepsin K in: