cathepsin S
Functional Attributes in Pathways
-
Substrates : 81 entries in CutDB for C01.034
Ext
-
BH3 interacting domain death agonist
-
cathepsin S preproprotein
-
Golli-mbp isoform 1
-
Golli-mbp isoform 2
-
laminin, gamma 2 isoform a precursor
-
laminin, gamma 2 isoform b precursor
-
myelin basic protein isoform 1
-
myelin basic protein isoform 2
-
myelin basic protein isoform 3
-
myelin basic protein isoform 4
-
Osteocalcin
-
secretory leukocyte peptidase inhibitor precursor
-
Secretory leukocyte peptidase inhibitor precursor
-
Substrate Specificity -- Under development
-
Inhibitors -- Under development
-
Pathways -- Under development
Recent News and Literature
- Detection of cathepsin S cysteine...Br J Neurosurg. 2007 Apr;21(2):204-9.
- Molecular fingerprinting and autocrine...Cancer Res 2006 Jan 1;66(1): p198-211
- Cathepsin S controls angiogenesis...J Biol Chem 2006 Mar 3;281(9): p6020-9
- Overexpression of cathepsin F, matrix...BMC Cancer 2005;5(1): p68
- Cathepsin S, a novel...FASEB J. 2005 Sep;19(11):1540-2. Epub 2005 Jun 28.
- Cathepsin K is the principal...Am J Pathol 2004 Aug;165(2): p593-600
- Cystatins....Biochem Soc Symp 2003;(70): p179-99
- The clinical significance of cathepsin...Am J Pathol 2003 Jul;163(1): p175-82
- Cathepsin S in tumours,...Br J Cancer. 2001 Oct 19;85(8):1193-200.
- The half-life of human...Eur J Biochem 1999 Aug;263(3): p717-25
- Pro-inflammatory cytokines induce expression...Am J Pathol 1999 Jun;154(6): p1755-62
- Quantification of cathepsins B and L in cells....Biochem J 1998 Jun 1;332 ( Pt 2): p499-505
Structural Features
MKRLVCVLLVCSSAVAQLHKDPTLDHHWHLWKKTYGKQYKEKNEEAVRRLIWEKNLKFVMLHNLEHSMGMHSYDLGMNHL
GDMTSEEVMSLMSSLRVPSQWQRNITYKSNPNRILPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLV
TLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKE
AVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHC
GIASFPSYPEI
Cross annotation in other databases
cathepsin S in:
Gene Cards
- Diseases
- Expression
- SNP
- Drugs
Other Links
- Human Protein Atlas
- iHOP
- GNF Sym Atlas
- NCBI Homologs
- OMIM
- MEROPS
Functional Attributes in Pathways
-
Substrates : 81 entries in CutDB for C01.034
Ext
- BH3 interacting domain death agonist
- cathepsin S preproprotein
- Golli-mbp isoform 1
- Golli-mbp isoform 2
- laminin, gamma 2 isoform a precursor
- laminin, gamma 2 isoform b precursor
- myelin basic protein isoform 1
- myelin basic protein isoform 2
- myelin basic protein isoform 3
- myelin basic protein isoform 4
- Osteocalcin
- secretory leukocyte peptidase inhibitor precursor
- Secretory leukocyte peptidase inhibitor precursor
- Substrate Specificity -- Under development
- Inhibitors -- Under development
- Pathways -- Under development
Recent News and Literature
- Detection of cathepsin S cysteine...Br J Neurosurg. 2007 Apr;21(2):204-9.
- Molecular fingerprinting and autocrine...Cancer Res 2006 Jan 1;66(1): p198-211
- Cathepsin S controls angiogenesis...J Biol Chem 2006 Mar 3;281(9): p6020-9
- Overexpression of cathepsin F, matrix...BMC Cancer 2005;5(1): p68
- Cathepsin S, a novel...FASEB J. 2005 Sep;19(11):1540-2. Epub 2005 Jun 28.
- Cathepsin K is the principal...Am J Pathol 2004 Aug;165(2): p593-600
- Cystatins....Biochem Soc Symp 2003;(70): p179-99
- The clinical significance of cathepsin...Am J Pathol 2003 Jul;163(1): p175-82
- Cathepsin S in tumours,...Br J Cancer. 2001 Oct 19;85(8):1193-200.
- The half-life of human...Eur J Biochem 1999 Aug;263(3): p717-25
- Pro-inflammatory cytokines induce expression...Am J Pathol 1999 Jun;154(6): p1755-62
- Quantification of cathepsins B and L in cells....Biochem J 1998 Jun 1;332 ( Pt 2): p499-505
Structural Features
MKRLVCVLLVCSSAVAQLHKDPTLDHHWHLWKKTYGKQYKEKNEEAVRRLIWEKNLKFVMLHNLEHSMGMHSYDLGMNHL
GDMTSEEVMSLMSSLRVPSQWQRNITYKSNPNRILPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLV
TLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKE
AVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHC
GIASFPSYPEI
Cross annotation in other databases
cathepsin S in:
- Gene Cards
- Diseases
- Expression
- SNP
- Drugs
- Other Links
- Human Protein Atlas
- iHOP
- GNF Sym Atlas
- NCBI Homologs
- OMIM
- MEROPS

