cathepsin H

Functional Attributes in Pathways

Recent News and Literature

  1. Cathepsin B, cathepsin H, cathepsin...Int J Biol Markers. 2008 July-September;23(3):161-168.
  2. Serum cathepsin H as a potential...Int J Biol Markers. 2004 Oct-Dec;19(4):289-94.
  3. Cysteine proteases and cell...Eukaryot Cell 2003 Dec;2(6): p1234-45
  4. [Activity of cathepsin H in blood...Vopr Onkol. 2001;47(5):590-4.
  5. Activity, expression, and transcription...Cancer 2001 Mar 1;91(5): p972-82
  6. Cathepsin H expression distinguishes...Anticancer Res. 2000 Jan-Feb;20(1B):537-40.
  7. Cysteine proteinase cathepsin H in tumours...Br J Cancer 2000 Feb;82(4): p782-8
  8. Crystal structure of porcine...Structure 1998 Jan 15;6(1): p51-61
  9. Isolation of tissue-type plasminogen...FEBS Lett 1996 Apr 29;385(1-2): p72-6
  10. Human breast milk contains...Biochem Mol Biol Int 1993 Aug;30(5): p921-8
  11. Cathepsin B activity in human...J Histochem Cytochem 1994 Jul;42(7): p917-29
  12. Characterization of cysteine proteases...Invasion Metastasis 1993;13(6): p301-13
  13. IFN-gamma increases cathepsin H mRNA...J Leukoc Biol 1995 Apr;57(4): p663-9
  14. Lysosomal proteases cathepsins D, B, H, L and their...Biol Chem Hoppe Seyler. 1995 Jul;376(7):401-5.
  15. Serum and tissue proteinase-like...Eur J Cancer Clin Oncol 1984 Feb;20(2): p203-8
  16. Cathepsin B-like activity in viable...Cancer Res 1985 Aug;45(8): p3636-41
  17. Proteinase-like peptidase activities in malignant...Br J Surg. 1985 May;72(5):386-8.
  18. Close relationship of the major...Cancer Res 1986 Sep;46(9): p4590-3
  19. The role of peptidases...Br J Surg 1985 May;72(5): p378-81
  20. Proteinase-like peptidase activities and oestrogen...J Cancer Res Clin Oncol 1989;115(1): p89-92

Structural Features

Structure has not yet been determined for this protein.



Click here to view a 3D model

[-] Domain Structure

Homologs

Sequence

MWATLPLLCAGAWLLGVPVCGAAELSVNSLEKFHFKSWMSKHRKTYSTEEYHHRLQTFASNWRKINAHNNGNHTFKMALN

QFSDMSFAEIKHKYLWSEPQNCSATKSNYLRGTGPYPPSVDWRKKGNFVSPVKNQGACGSCWTFSTTGALESAIAIATGK

MLSLAEQQLVDCAQDFNNHGCQGGLPSQAFEYILYNKGIMGEDTYPYQGKDGYCKFQPGKAIGFVKDVANITIYDEEAMV

EAVALYNPVSFAFEVTQDFMMYRTGIYSSTSCHKTPDKVNHAVLAVGYGEKNGIPYWIVKNSWGPQWGMNGYFLIERGKN

MCGLAACASYPIPLV

Cross annotation in other databases

cathepsin H in: