furin
Functional Attributes in Pathways
-
Substrates : 147 entries in CutDB for S08.071
Ext
-
integrin alpha 5 precursor
-
parathyroid hormone preproprotein
-
a disintegrin and metalloprotease domain 15 (metargidin) isoform a
-
a disintegrin and metalloprotease domain 17
-
ADAM metallopeptidase domain 10 precursor
-
Adam metallopeptidase domain 12 isoform 1 preproprotein
-
ADAM metallopeptidase domain 17 preproprotein
-
Adam metallopeptidase domain 19 isoform 1 preproprotein
-
Adam metallopeptidase with thrombospondin type 1 motif, 1 preproprotein
-
ADAM metallopeptidase with thrombospondin type 1 motif, 1 preproprotein
-
ADAM metallopeptidase with thrombospondin type 1 motif, 12
-
ADAM metallopeptidase with thrombospondin type 1 motif, 4 preproprotein
-
ADAM metallopeptidase with thrombospondin type 1 motif, 9 preproprotein
-
Aerolysin precursor
-
albumin precursor
-
alpha-toxin
-
ATPase, H+ transporting, lysosomal accessory protein 1
-
beta-site APP cleaving enzyme 1
-
Beta-site app-cleaving enzyme 1 isoform a preproprotein
-
bone morphogenetic protein 1 isoform 1, precursor
-
bone morphogenetic protein 4 preproprotein
-
coagulation factor IX
-
collagen, type XXIII, alpha 1
-
cubilin
-
Desmoglein 3 preproprotein
-
diphtheria toxin precursor
-
Diphtheria toxin precursor
-
E2 glycoprotein precursor
-
Ectodysplasin a isoform eda-a1
-
endothelial lipase precursor
-
endothelin 1
-
exotoxin A precursor
-
fibrillin 1
-
furin
-
furin preproprotein
-
Furin preproprotein
-
furin-like prohormone convertase
-
furin1-X
-
fusion protein
-
gliomedin
-
glycoprotein B GII
-
gp40/gp15
-
growth differentiation factor 5 preproprotein
-
hemagglutinin
-
hemagglutinin precursor
-
hemojuvelin
-
hepcidin antimicrobial peptide preproprotein
-
HPIV3 F fusion glycoprotein
-
hypothetical protein FFV_gp1
-
IGF-1a
-
insulin receptor
-
insulin-like 6
-
integrin alpha 3 isoform a precursor
-
integrin alpha 4 precursor
-
integrin alpha chain, alpha 6
-
integrin alpha chain, alpha 6 isoform a precursor
-
kermit CG11546-PA, isoform A
-
lactase-phlorizin hydrolase preproprotein
-
Leukocyte cell derived chemotaxin 1 isoform 1 precursor
-
Low density lipoprotein-related protein 1
-
matrix metalloproteinase 11 preproprotein
-
matrix metalloproteinase 14 preproprotein
-
matrix metalloproteinase 16 isoform 1 preproprotein
-
matrix metalloproteinase 2 preproprotein
-
matrix metalloproteinase 24
-
matrix metalloproteinase 3 preproprotein
-
Matrix metalloproteinase-21 precursor (MMP-21) (xMMP)
-
meprin A, alpha (PABA peptide hydrolase)
-
met proto-oncogene precursor
-
minor capsid protein
-
myostatin
-
natriuretic peptide precursor B preproprotein
-
nerve growth factor, beta
-
neurotrophin 3 precursor
-
Notch1 preproprotein
-
ORF of MTV-7
-
parathyroid hormone preproprotein
-
platelet-derived growth factor alpha isoform 1 preproprotein
-
platelet-derived growth factor beta isoform 1, preproprotein
-
platelet-derived growth factor beta isoform 2, preproprotein
-
pro-melanin-concentrating hormone
-
pro-Mullerian inhibiting substance
-
Proline-rich protein bstni subfamily 4 precursor
-
proprotein convertase subtilisin/kexin type 9 preproprotein
-
protective antigen
-
protein C (inactivator of coagulation factors Va and VIIIa)
-
protein tyrosine phosphatase, receptor type, K
-
ROLler: helically twisted, animals roll when moving family member (rol-6)
-
secretory granule neuroendocrine protein 1, 7B2 protein
-
secretory granule, neuroendocrine protein 1 (7B2 protein)
-
semaphorin D
-
serine peptidase inhibitor, Kazal type 5 isoform a precursor
-
serine peptidase inhibitor, Kazal type 5 isoform b precursor
-
serine peptidase inhibitor, Kazal type 5 isoform c precursor
-
Shiga toxin I subunit A precursor
-
sodium channel, nonvoltage-gated 1 alpha
-
sodium channel, nonvoltage-gated 1 gamma
-
sodium channel, nonvoltage-gated, type I, alpha
-
Sortilin-related receptor containing ldlr class a repeats preproprotein
-
SQuaT family member (sqt-1)
-
Structural polyprotein (p130)
-
superoxide dismutase 3, extracellular precursor
-
transforming growth factor, beta 1
-
transmembrane receptor Notch1
-
Tumor necrosis factor (ligand) superfamily, member 12-member 13
-
UL55; gB
-
urotensin 2 isoform b preproprotein
-
vascular endothelial growth factor C preproprotein
-
vascular endothelial growth factor D preproprotein
-
virion spike glycoprotein precursor
-
von Willebrand factor precursor
-
zona pellucida glycoprotein 2
-
Zona pellucida glycoprotein 3 preproprotein
-
Zona pellucida sperm-binding protein 4 precursor
-
ZP1 precursor
-
Substrate Specificity -- Under development
-
Inhibitors -- Under development
-
Pathways -- Under development
Recent News and Literature
We currently do not have custom news for this protein.
Structural Features
MELRSWLLWVVAAAGAVVLLAADAQGQKIFTNTWAVHIPGGPAVADRVAQKHGFHNLGQIFGDYYHFWHRAVTKRSLSPH
RPRHSRLQREPQVKWLEQQVAKRRAKRDVYQEPTDPKFPQQWYLSGVTQRDLNVKEAWAQGFTGHGIVVSILDDGIEKNH
PDLAGNYDPGASFDVNDQDPDPQPRYTQMNDNRHGTRCAGEVAAVANNGVCGVGVAYNARIGGVRMLDGEVTDAVEARSL
GLNPNHIHIYSASWGPEDDGKTVDGPARLAEEAFFRGVSQGRGGLGSIFVWASGNGGREHDSCNCDGYTNSIYTLSISSA
TQFGNVPWYSEACSSTLATTYSSGNQNEKQIVTTDLRQKCTESHTGTSASAPLAAGIIALTLEANKNLTWRDMQHLVVQT
SKPAHLNADDWATNGVGRKVSHSYGYGLLDAGAMVALAQNWTTVAPQRKCIVEILVEPKDIGKRLEVRKAVTACLGEPNH
ITRLEHVQARLTLSYNRRGDLAIHLISPMGTRSTLLAARPHDYSADGFNDWAFMTTHSWDEDPAGEWVLEIENTSEANNY
GTLTKFTLVLYGTAPEGLSTPPESSGCKTLTSSQACVVCEEGYSLHQKSCVQHCPPGFIPQVLDTHYSTENDVEIIRASV
CTPCHASCATCQGPAPTDCLSCPSHASLDPVEQTCSRQSQSSRESRPQQQPPALRPEVEMEPRLQAGLASHLPEVLAGLS
CLIIVLIFGIVFLFLHRCSGFSFRGMKVYTMDRGLISYKGLPPEAWQEECPSDSEEDEGRGERTAFIKDQSAL
Cross annotation in other databases
furin in:
Gene Cards
- Diseases
- Expression
- SNP
- Drugs
Other Links
- Human Protein Atlas
- iHOP
- GNF Sym Atlas
- NCBI Homologs
- OMIM
- MEROPS
Functional Attributes in Pathways
-
Substrates : 147 entries in CutDB for S08.071
Ext
- integrin alpha 5 precursor
- parathyroid hormone preproprotein
- a disintegrin and metalloprotease domain 15 (metargidin) isoform a
- a disintegrin and metalloprotease domain 17
- ADAM metallopeptidase domain 10 precursor
- Adam metallopeptidase domain 12 isoform 1 preproprotein
- ADAM metallopeptidase domain 17 preproprotein
- Adam metallopeptidase domain 19 isoform 1 preproprotein
- Adam metallopeptidase with thrombospondin type 1 motif, 1 preproprotein
- ADAM metallopeptidase with thrombospondin type 1 motif, 1 preproprotein
- ADAM metallopeptidase with thrombospondin type 1 motif, 12
- ADAM metallopeptidase with thrombospondin type 1 motif, 4 preproprotein
- ADAM metallopeptidase with thrombospondin type 1 motif, 9 preproprotein
- Aerolysin precursor
- albumin precursor
- alpha-toxin
- ATPase, H+ transporting, lysosomal accessory protein 1
- beta-site APP cleaving enzyme 1
- Beta-site app-cleaving enzyme 1 isoform a preproprotein
- bone morphogenetic protein 1 isoform 1, precursor
- bone morphogenetic protein 4 preproprotein
- coagulation factor IX
- collagen, type XXIII, alpha 1
- cubilin
- Desmoglein 3 preproprotein
- diphtheria toxin precursor
- Diphtheria toxin precursor
- E2 glycoprotein precursor
- Ectodysplasin a isoform eda-a1
- endothelial lipase precursor
- endothelin 1
- exotoxin A precursor
- fibrillin 1
- furin
- furin preproprotein
- Furin preproprotein
- furin-like prohormone convertase
- furin1-X
- fusion protein
- gliomedin
- glycoprotein B GII
- gp40/gp15
- growth differentiation factor 5 preproprotein
- hemagglutinin
- hemagglutinin precursor
- hemojuvelin
- hepcidin antimicrobial peptide preproprotein
- HPIV3 F fusion glycoprotein
- hypothetical protein FFV_gp1
- IGF-1a
- insulin receptor
- insulin-like 6
- integrin alpha 3 isoform a precursor
- integrin alpha 4 precursor
- integrin alpha chain, alpha 6
- integrin alpha chain, alpha 6 isoform a precursor
- kermit CG11546-PA, isoform A
- lactase-phlorizin hydrolase preproprotein
- Leukocyte cell derived chemotaxin 1 isoform 1 precursor
- Low density lipoprotein-related protein 1
- matrix metalloproteinase 11 preproprotein
- matrix metalloproteinase 14 preproprotein
- matrix metalloproteinase 16 isoform 1 preproprotein
- matrix metalloproteinase 2 preproprotein
- matrix metalloproteinase 24
- matrix metalloproteinase 3 preproprotein
- Matrix metalloproteinase-21 precursor (MMP-21) (xMMP)
- meprin A, alpha (PABA peptide hydrolase)
- met proto-oncogene precursor
- minor capsid protein
- myostatin
- natriuretic peptide precursor B preproprotein
- nerve growth factor, beta
- neurotrophin 3 precursor
- Notch1 preproprotein
- ORF of MTV-7
- parathyroid hormone preproprotein
- platelet-derived growth factor alpha isoform 1 preproprotein
- platelet-derived growth factor beta isoform 1, preproprotein
- platelet-derived growth factor beta isoform 2, preproprotein
- pro-melanin-concentrating hormone
- pro-Mullerian inhibiting substance
- Proline-rich protein bstni subfamily 4 precursor
- proprotein convertase subtilisin/kexin type 9 preproprotein
- protective antigen
- protein C (inactivator of coagulation factors Va and VIIIa)
- protein tyrosine phosphatase, receptor type, K
- ROLler: helically twisted, animals roll when moving family member (rol-6)
- secretory granule neuroendocrine protein 1, 7B2 protein
- secretory granule, neuroendocrine protein 1 (7B2 protein)
- semaphorin D
- serine peptidase inhibitor, Kazal type 5 isoform a precursor
- serine peptidase inhibitor, Kazal type 5 isoform b precursor
- serine peptidase inhibitor, Kazal type 5 isoform c precursor
- Shiga toxin I subunit A precursor
- sodium channel, nonvoltage-gated 1 alpha
- sodium channel, nonvoltage-gated 1 gamma
- sodium channel, nonvoltage-gated, type I, alpha
- Sortilin-related receptor containing ldlr class a repeats preproprotein
- SQuaT family member (sqt-1)
- Structural polyprotein (p130)
- superoxide dismutase 3, extracellular precursor
- transforming growth factor, beta 1
- transmembrane receptor Notch1
- Tumor necrosis factor (ligand) superfamily, member 12-member 13
- UL55; gB
- urotensin 2 isoform b preproprotein
- vascular endothelial growth factor C preproprotein
- vascular endothelial growth factor D preproprotein
- virion spike glycoprotein precursor
- von Willebrand factor precursor
- zona pellucida glycoprotein 2
- Zona pellucida glycoprotein 3 preproprotein
- Zona pellucida sperm-binding protein 4 precursor
- ZP1 precursor
- Substrate Specificity -- Under development
- Inhibitors -- Under development
- Pathways -- Under development
Recent News and Literature
Structural Features
MELRSWLLWVVAAAGAVVLLAADAQGQKIFTNTWAVHIPGGPAVADRVAQKHGFHNLGQIFGDYYHFWHRAVTKRSLSPH
RPRHSRLQREPQVKWLEQQVAKRRAKRDVYQEPTDPKFPQQWYLSGVTQRDLNVKEAWAQGFTGHGIVVSILDDGIEKNH
PDLAGNYDPGASFDVNDQDPDPQPRYTQMNDNRHGTRCAGEVAAVANNGVCGVGVAYNARIGGVRMLDGEVTDAVEARSL
GLNPNHIHIYSASWGPEDDGKTVDGPARLAEEAFFRGVSQGRGGLGSIFVWASGNGGREHDSCNCDGYTNSIYTLSISSA
TQFGNVPWYSEACSSTLATTYSSGNQNEKQIVTTDLRQKCTESHTGTSASAPLAAGIIALTLEANKNLTWRDMQHLVVQT
SKPAHLNADDWATNGVGRKVSHSYGYGLLDAGAMVALAQNWTTVAPQRKCIVEILVEPKDIGKRLEVRKAVTACLGEPNH
ITRLEHVQARLTLSYNRRGDLAIHLISPMGTRSTLLAARPHDYSADGFNDWAFMTTHSWDEDPAGEWVLEIENTSEANNY
GTLTKFTLVLYGTAPEGLSTPPESSGCKTLTSSQACVVCEEGYSLHQKSCVQHCPPGFIPQVLDTHYSTENDVEIIRASV
CTPCHASCATCQGPAPTDCLSCPSHASLDPVEQTCSRQSQSSRESRPQQQPPALRPEVEMEPRLQAGLASHLPEVLAGLS
CLIIVLIFGIVFLFLHRCSGFSFRGMKVYTMDRGLISYKGLPPEAWQEECPSDSEEDEGRGERTAFIKDQSAL
Cross annotation in other databases
furin in:
- Gene Cards
- Diseases
- Expression
- SNP
- Drugs
- Other Links
- Human Protein Atlas
- iHOP
- GNF Sym Atlas
- NCBI Homologs
- OMIM
- MEROPS

