plasmin
Functional Attributes in Pathways
-
Substrates : 116 entries in CutDB for S01.233
Ext
-
aggrecan core protein (Homo sapiens)
-
alpha-2-plasmin inhibitor
-
anti-Mullerian hormone
-
apolipoprotein H precursor
-
Apolipoprotein h precursor
-
brain derived neurotrophic factor
-
brain-derived neurotrophic factor isoform a preproprotein
-
brain-derived neurotrophic factor isoform b preproprotein
-
brain-derived neurotrophic factor isoform c preproprotein
-
Ceruloplasmin (ferroxidase)
-
chromogranin A precursor
-
Coagulation factor ii (thrombin) receptor-like 1 precursor
-
coagulation factor II (thrombin) receptor-like 3 precursor
-
coagulation factor II receptor precursor
-
coagulation factor V precursor
-
Coagulation factor X preproprotein
-
coagulation factor X preproprotein
-
elafin preproprotein
-
fibrinogen, alpha polypeptide isoform alpha preproprotein
-
fibrinogen, alpha polypeptide isoform alpha-E preproprotein
-
fibrinogen, beta chain preproprotein
-
fibrinogen, gamma chain isoform gamma-A precursor
-
fibrinogen, gamma chain isoform gamma-B precursor
-
heparan sulfate proteoglycan core protein
-
Histidine-rich glycoprotein precursor
-
IgG1 heavy chain (hinge region)
-
insulin-like growth factor binding protein 1 isoform a precursor
-
Insulin-like growth factor binding protein 3 isoform b precursor
-
kallikrein 11 isoform 1 preproprotein
-
kallikrein 11 isoform 2 preproprotein
-
L1 cell adhesion molecule isoform 1 precursor
-
laminin, alpha 1 precursor
-
latent transforming growth factor beta binding protein 1 isoform LTBP-1L
-
latent transforming growth factor beta binding protein 1 isoform LTBP-1S
-
matrix metalloproteinase 1 preproprotein
-
matrix metalloproteinase 13 preproprotein
-
matrix metalloproteinase 14 preproprotein
-
matrix metalloproteinase 2 preproprotein
-
Meprin a, alpha (paba peptide hydrolase)
-
N-methyl-D-aspartate receptor subunit 2A isoform 1 precursor
-
N-methyl-D-aspartate receptor subunit 2A isoform 2 precursor
-
nerve growth factor, beta polypeptide precursor
-
nidogen 1
-
osteocalcin preproprotein
-
plasminogen
-
plasminogen (activated)
-
plasminogen activator, tissue type isoform 1 preproprotein
-
plasminogen activator, urokinase receptor
-
Plasminogen activator, urokinase receptor isoform 1 precursor
-
plasminogen activator, urokinase receptor isoform 1 precursor
-
plasminogen activator, urokinase receptor isoform 2 precursor
-
plasminogen activator, urokinase receptor isoform 3 precursor
-
Procollagen c-endopeptidase enhancer
-
sodium channel, nonvoltage-gated 1 gamma
-
spondin 1, extracellular matrix protein
-
syndecan 4 precursor
-
u-plasminogen activator precursor
-
urokinase plasminogen activator preproprotein
-
vascular endothelial growth factor A isoform d precursor
-
vascular endothelial growth factor A isoform e precursor
-
vascular endothelial growth factor A isoform g precursor
-
vascular endothelial growth factor D preproprotein
-
vitronectin (Homo sapiens)
-
Substrate Specificity -- Under development
-
Inhibitors -- Under development
-
Pathways -- Under development
Recent News and Literature
We currently do not have custom news for this protein.
Structural Features
MEHKEVVLLLLLFLKSGQGEPLDDYVNTQGASLFSVTKKQLGAGSIEECAAKCEEDEEFTCRAFQYHSKEQQCVIMAENR
KSSIIIRMRDVVLFEKKVYLSECKTGNGKNYRGTMSKTKNGITCQKWSSTSPHRPRFSPATHPSEGLEENYCRNPDNDPQ
GPWCYTTDPEKRYDYCDILECEEECMHCSGENYDGKISKTMSGLECQAWDSQSPHAHGYIPSKFPNKNLKKNYCRNPDRE
LRPWCFTTDPNKRWELCDIPRCTTPPPSSGPTYQCLKGTGENYRGNVAVTVSGHTCQHWSAQTPHTHNRTPENFPCKNLD
ENYCRNPDGKRAPWCHTTNSQVRWEYCKIPSCDSSPVSTEQLAPTAPPELTPVVQDCYHGDGQSYRGTSSTTTTGKKCQS
WSSMTPHRHQKTPENYPNAGLTMNYCRNPDADKGPWCFTTDPSVRWEYCNLKKCSGTEASVVAPPPVVLLPDVETPSEED
CMFGNGKGYRGKRATTVTGTPCQDWAAQEPHRHSIFTPETNPRAGLEKNYCRNPDGDVGGPWCYTTNPRKLYDYCDVPQC
AAPSFDCGKPQVEPKKCPGRVVGGCVAHPHSWPWQVSLRTRFGMHFCGGTLISPEWVLTAAHCLEKSPRPSSYKVILGAH
QEVNLEPHVQEIEVSRLFLEPTRKDIALLKLSSPAVITDKVIPACLPSPNYVVADRTECFITGWGETQGTFGAGLLKEAQ
LPVIENKVCNRYEFLNGRVQSTELCAGHLAGGTDSCQGDSGGPLVCFEKDKYILQGVTSWGLGCARPNKPGVYVRVSRFV
TWIEGVMRNN
Cross annotation in other databases
plasmin in:
Gene Cards
- Diseases
- Expression
- SNP
- Drugs
Other Links
- Human Protein Atlas
- iHOP
- GNF Sym Atlas
- NCBI Homologs
- OMIM
- MEROPS
Functional Attributes in Pathways
-
Substrates : 116 entries in CutDB for S01.233
Ext
- aggrecan core protein (Homo sapiens)
- alpha-2-plasmin inhibitor
- anti-Mullerian hormone
- apolipoprotein H precursor
- Apolipoprotein h precursor
- brain derived neurotrophic factor
- brain-derived neurotrophic factor isoform a preproprotein
- brain-derived neurotrophic factor isoform b preproprotein
- brain-derived neurotrophic factor isoform c preproprotein
- Ceruloplasmin (ferroxidase)
- chromogranin A precursor
- Coagulation factor ii (thrombin) receptor-like 1 precursor
- coagulation factor II (thrombin) receptor-like 3 precursor
- coagulation factor II receptor precursor
- coagulation factor V precursor
- Coagulation factor X preproprotein
- coagulation factor X preproprotein
- elafin preproprotein
- fibrinogen, alpha polypeptide isoform alpha preproprotein
- fibrinogen, alpha polypeptide isoform alpha-E preproprotein
- fibrinogen, beta chain preproprotein
- fibrinogen, gamma chain isoform gamma-A precursor
- fibrinogen, gamma chain isoform gamma-B precursor
- heparan sulfate proteoglycan core protein
- Histidine-rich glycoprotein precursor
- IgG1 heavy chain (hinge region)
- insulin-like growth factor binding protein 1 isoform a precursor
- Insulin-like growth factor binding protein 3 isoform b precursor
- kallikrein 11 isoform 1 preproprotein
- kallikrein 11 isoform 2 preproprotein
- L1 cell adhesion molecule isoform 1 precursor
- laminin, alpha 1 precursor
- latent transforming growth factor beta binding protein 1 isoform LTBP-1L
- latent transforming growth factor beta binding protein 1 isoform LTBP-1S
- matrix metalloproteinase 1 preproprotein
- matrix metalloproteinase 13 preproprotein
- matrix metalloproteinase 14 preproprotein
- matrix metalloproteinase 2 preproprotein
- Meprin a, alpha (paba peptide hydrolase)
- N-methyl-D-aspartate receptor subunit 2A isoform 1 precursor
- N-methyl-D-aspartate receptor subunit 2A isoform 2 precursor
- nerve growth factor, beta polypeptide precursor
- nidogen 1
- osteocalcin preproprotein
- plasminogen
- plasminogen (activated)
- plasminogen activator, tissue type isoform 1 preproprotein
- plasminogen activator, urokinase receptor
- Plasminogen activator, urokinase receptor isoform 1 precursor
- plasminogen activator, urokinase receptor isoform 1 precursor
- plasminogen activator, urokinase receptor isoform 2 precursor
- plasminogen activator, urokinase receptor isoform 3 precursor
- Procollagen c-endopeptidase enhancer
- sodium channel, nonvoltage-gated 1 gamma
- spondin 1, extracellular matrix protein
- syndecan 4 precursor
- u-plasminogen activator precursor
- urokinase plasminogen activator preproprotein
- vascular endothelial growth factor A isoform d precursor
- vascular endothelial growth factor A isoform e precursor
- vascular endothelial growth factor A isoform g precursor
- vascular endothelial growth factor D preproprotein
- vitronectin (Homo sapiens)
- Substrate Specificity -- Under development
- Inhibitors -- Under development
- Pathways -- Under development
Recent News and Literature
Structural Features
MEHKEVVLLLLLFLKSGQGEPLDDYVNTQGASLFSVTKKQLGAGSIEECAAKCEEDEEFTCRAFQYHSKEQQCVIMAENR
KSSIIIRMRDVVLFEKKVYLSECKTGNGKNYRGTMSKTKNGITCQKWSSTSPHRPRFSPATHPSEGLEENYCRNPDNDPQ
GPWCYTTDPEKRYDYCDILECEEECMHCSGENYDGKISKTMSGLECQAWDSQSPHAHGYIPSKFPNKNLKKNYCRNPDRE
LRPWCFTTDPNKRWELCDIPRCTTPPPSSGPTYQCLKGTGENYRGNVAVTVSGHTCQHWSAQTPHTHNRTPENFPCKNLD
ENYCRNPDGKRAPWCHTTNSQVRWEYCKIPSCDSSPVSTEQLAPTAPPELTPVVQDCYHGDGQSYRGTSSTTTTGKKCQS
WSSMTPHRHQKTPENYPNAGLTMNYCRNPDADKGPWCFTTDPSVRWEYCNLKKCSGTEASVVAPPPVVLLPDVETPSEED
CMFGNGKGYRGKRATTVTGTPCQDWAAQEPHRHSIFTPETNPRAGLEKNYCRNPDGDVGGPWCYTTNPRKLYDYCDVPQC
AAPSFDCGKPQVEPKKCPGRVVGGCVAHPHSWPWQVSLRTRFGMHFCGGTLISPEWVLTAAHCLEKSPRPSSYKVILGAH
QEVNLEPHVQEIEVSRLFLEPTRKDIALLKLSSPAVITDKVIPACLPSPNYVVADRTECFITGWGETQGTFGAGLLKEAQ
LPVIENKVCNRYEFLNGRVQSTELCAGHLAGGTDSCQGDSGGPLVCFEKDKYILQGVTSWGLGCARPNKPGVYVRVSRFV
TWIEGVMRNN
Cross annotation in other databases
plasmin in:
- Gene Cards
- Diseases
- Expression
- SNP
- Drugs
- Other Links
- Human Protein Atlas
- iHOP
- GNF Sym Atlas
- NCBI Homologs
- OMIM
- MEROPS

