KLK3/PSA

Functional Attributes in Pathways

Recent News and Literature

  1. Total Prostate Specific Antigen...J Urol. 2008 Jun 10;.
  2. [-2]Proenzyme Prostate Specific Antigen...J Urol. 2008 Jun 10;.
  3. The Performance of Prostate...J Urol. 2008 Jun 10;.
  4. Highly specific detection of...BJU Int. 2008 Jun 11;.
  5. Pathologic stage T2a and...Prostate. 2008 Jun 9;.
  6. Associations of lower urinary...BJU Int. 2008 Jun 6;.
  7. [Prostate specific antigen: Utilization...Cancer Radiother. 2008 Jun 6;.
  8. An artificial neural network...BJU Int. 2008 Jun 3;.
  9. Association between serum prostate-specific...BJU Int. 2008 Jun 3;.
  10. Inverse Relationship Between Obesity...Urology. 2008 May 30;.
  11. The Comparability of Models...Eur Urol. 2008 May 22;.
  12. Quality of Life, Morbidity,...Clin Genitourin Cancer. 2008 Mar;6(1):46-52.
  13. Novel small molecule inhibitors...Prostate. 2008 May 23;.
  14. High Expression of KLK14...Tumour Biol. 2008;29(1):1-8. Epub 2008 May 23.
  15. Shorter CAG repeats in...Cancer Lett. 2008 May 19;.
  16. Detecting prostate cancer by...Eur J Clin Invest. 2008 Jun;38(6):430-7.
  17. Are prostate biopsies mandatory...Prostate. 2008 May 15;.
  18. Why determine only the...Ann Clin Biochem. 2008 May;45(Pt 3):270-4.
  19. Case records of the...N Engl J Med. 2008 May 15;358(20):2161-8.
  20. WHAT IS THE FUTURE...BJU Int. 2008 May 12;.

Structural Features

Structure has not yet been determined for this protein.



Click here to view a 3D model

[-] Domain Structure

Homologs

Sequence

MWVPVVFLTLSVTWIGAAPLILSRIVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRHSL

FHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSI

EPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERP

SLYTKVVHYRKWIKDTIVANP

Cross annotation in other databases

KLK3/PSA in: