KLK2
Functional Attributes in Pathways
-
Substrates : 55 entries in CutDB for S01.161
Ext
-
ADAM metallopeptidase with thrombospondin type 1 motif, 8 preproprotein
-
alpha 1 type IX collagen isoform 1 precursor
-
Alpha-2-plasmin inhibitor
-
FAT tumor suppressor homolog 1 (Drosophila), isoform CRA_c
-
fibronectin 1 isoform 1 preproprotein
-
fibronectin 1 isoform 2 preproprotein
-
fibronectin 1 isoform 3 preproprotein
-
fibronectin 1 isoform 4 preproprotein
-
fibronectin 1 isoform 5 preproprotein
-
fibronectin 1 isoform 6 preproprotein
-
fibronectin 1 isoform 7 preproprotein
-
Gurmarin (Sweet taste-suppressing peptide)
-
H-kininogen
-
H-kininogen (Homo sapiens)
-
insulin-like growth factor binding protein 2, 36kDa
-
insulin-like growth factor binding protein 3 isoform a precursor
-
insulin-like growth factor binding protein 3 isoform b precursor
-
insulin-like growth factor binding protein 4 precursor
-
insulin-like growth factor binding protein 5
-
kallikrein 11 isoform 1 preproprotein
-
kallikrein 11 isoform 2 preproprotein
-
kallikrein 2, prostatic isoform 1
-
kallikrein 2, prostatic isoform 2
-
kallikrein hK2 precursor
-
kininogen 1 isoform 1
-
Plasminogen activator inhibitor-1
-
prostate specific antigen isoform 1 preproprotein
-
prostate specific antigen isoform 3 preproprotein
-
prostate specific antigen isoform 4 preproprotein
-
prostate specific antigen isoform 5 preproprotein
-
semenogelin I isoform a preproprotein
-
semenogelin I isoform b preproprotein
-
Semenogelin ii precursor
-
Serine (or cysteine) proteinase inhibitor, clade a (alpha-1 antiproteinase, antitrypsin), member 5
-
Serpin peptidase inhibitor, clade a, member 3 precursor
-
u-plasminogen activator precursor
-
Substrate Specificity -- Under development
-
Inhibitors -- Under development
-
Pathways -- Under development
Recent News and Literature
- Activation of hepatocyte growth...FEBS J. 2008 Mar;275(5):1003-17. Epub 2008 Jan 25.
- PSA and other tissue...Eur J Cancer. 2007 Sep;43(13):1918-26. Epub 2007 Aug 3.
- [Molecular forms of PSA]...Prog Urol. 2007 Apr;17(2):165-71.
- Activity and stability of...J Pept Sci. 2007 May;13(5):348-53.
- Human tissue kallikreins: the...Cancer Lett. 2007 Apr 28;249(1):61-79. Epub 2007 Jan 31.
- Long-term prediction of prostate...J Clin Oncol. 2007 Feb 1;25(4):431-6.
- Is there an inter-relationship...Steroids. 2007 Apr;72(4):335-41. Epub 2006 Dec 19.
- Variants of the hK2...Clin Cancer Res. 2006 Nov 1;12(21):6452-8.
- Free and total human...Urology. 2006 Jul;68(1):219-25.
- mRNA expression analysis of...Biol Chem. 2006 Jun;387(6):789-93.
- The role of kallikrein-related...Biol Chem. 2006 Jun;387(6):707-14.
- Identification of genes targeted...Oncogene. 2006 Nov 23;25(55):7311-23. Epub 2006 Jun 5.
- Mutant recombinant serpins as...FEBS J. 2006 Jun;273(11):2505-14.
- Novel peptide inhibitors of...J Biol Chem. 2006 May 5;281(18):12555-60. Epub 2006 Mar 9.
- High-speed biomarker identification utilizing...Electrophoresis 2006 Mar;27(5-6): p1093-103
- Prostate specific antigen isoforms...J Urol 2006 Jan;175(1): p104-7
- The use of genetic...Clin Cancer Res. 2005 Dec 1;11(23):8391-7.
- Pharmacokinetics, biodistribution, and antitumor...Prostate 2006 Mar 1;66(4): p358-68
- Kallikrein 4 (hK4) and...Endocr Relat Cancer 2005 Sep;12(3): p631-43
- Risk assessment for biochemical...Int J Cancer 2006 Mar 1;118(5): p1234-40
Structural Features
MWDLVLSIALSVGCTGAVPLIQSRIVGGWECEKHSQPWQVAVYSHGWAHCGGVLVHPQWVLTAAHCLKKNSQVWLGRHNL
FEPEDTGQRVPVSHSFPHPLYNMSLLKHQSLRPDEDSSHDLMLLRLSEPAKITDVVKVLGLPTQEPALGTTCYASGWGSI
EPEEFLRPRSLQCVSLHLLSNDMCARAYSEKVTEFMLCAGLWTGGKDTCGGDSGGPLVCNGVLQGITSWGPEPCALPEKP
AVYTKVVHYRKWIKDTIAANP
Cross annotation in other databases
KLK2 in:
Gene Cards
- Diseases
- Expression
- SNP
- Drugs
Other Links
- Human Protein Atlas
- iHOP
- GNF Sym Atlas
- NCBI Homologs
- OMIM
- MEROPS
Functional Attributes in Pathways
-
Substrates : 55 entries in CutDB for S01.161
Ext
- ADAM metallopeptidase with thrombospondin type 1 motif, 8 preproprotein
- alpha 1 type IX collagen isoform 1 precursor
- Alpha-2-plasmin inhibitor
- FAT tumor suppressor homolog 1 (Drosophila), isoform CRA_c
- fibronectin 1 isoform 1 preproprotein
- fibronectin 1 isoform 2 preproprotein
- fibronectin 1 isoform 3 preproprotein
- fibronectin 1 isoform 4 preproprotein
- fibronectin 1 isoform 5 preproprotein
- fibronectin 1 isoform 6 preproprotein
- fibronectin 1 isoform 7 preproprotein
- Gurmarin (Sweet taste-suppressing peptide)
- H-kininogen
- H-kininogen (Homo sapiens)
- insulin-like growth factor binding protein 2, 36kDa
- insulin-like growth factor binding protein 3 isoform a precursor
- insulin-like growth factor binding protein 3 isoform b precursor
- insulin-like growth factor binding protein 4 precursor
- insulin-like growth factor binding protein 5
- kallikrein 11 isoform 1 preproprotein
- kallikrein 11 isoform 2 preproprotein
- kallikrein 2, prostatic isoform 1
- kallikrein 2, prostatic isoform 2
- kallikrein hK2 precursor
- kininogen 1 isoform 1
- Plasminogen activator inhibitor-1
- prostate specific antigen isoform 1 preproprotein
- prostate specific antigen isoform 3 preproprotein
- prostate specific antigen isoform 4 preproprotein
- prostate specific antigen isoform 5 preproprotein
- semenogelin I isoform a preproprotein
- semenogelin I isoform b preproprotein
- Semenogelin ii precursor
- Serine (or cysteine) proteinase inhibitor, clade a (alpha-1 antiproteinase, antitrypsin), member 5
- Serpin peptidase inhibitor, clade a, member 3 precursor
- u-plasminogen activator precursor
- Substrate Specificity -- Under development
- Inhibitors -- Under development
- Pathways -- Under development
Recent News and Literature
- Activation of hepatocyte growth...FEBS J. 2008 Mar;275(5):1003-17. Epub 2008 Jan 25.
- PSA and other tissue...Eur J Cancer. 2007 Sep;43(13):1918-26. Epub 2007 Aug 3.
- [Molecular forms of PSA]...Prog Urol. 2007 Apr;17(2):165-71.
- Activity and stability of...J Pept Sci. 2007 May;13(5):348-53.
- Human tissue kallikreins: the...Cancer Lett. 2007 Apr 28;249(1):61-79. Epub 2007 Jan 31.
- Long-term prediction of prostate...J Clin Oncol. 2007 Feb 1;25(4):431-6.
- Is there an inter-relationship...Steroids. 2007 Apr;72(4):335-41. Epub 2006 Dec 19.
- Variants of the hK2...Clin Cancer Res. 2006 Nov 1;12(21):6452-8.
- Free and total human...Urology. 2006 Jul;68(1):219-25.
- mRNA expression analysis of...Biol Chem. 2006 Jun;387(6):789-93.
- The role of kallikrein-related...Biol Chem. 2006 Jun;387(6):707-14.
- Identification of genes targeted...Oncogene. 2006 Nov 23;25(55):7311-23. Epub 2006 Jun 5.
- Mutant recombinant serpins as...FEBS J. 2006 Jun;273(11):2505-14.
- Novel peptide inhibitors of...J Biol Chem. 2006 May 5;281(18):12555-60. Epub 2006 Mar 9.
- High-speed biomarker identification utilizing...Electrophoresis 2006 Mar;27(5-6): p1093-103
- Prostate specific antigen isoforms...J Urol 2006 Jan;175(1): p104-7
- The use of genetic...Clin Cancer Res. 2005 Dec 1;11(23):8391-7.
- Pharmacokinetics, biodistribution, and antitumor...Prostate 2006 Mar 1;66(4): p358-68
- Kallikrein 4 (hK4) and...Endocr Relat Cancer 2005 Sep;12(3): p631-43
- Risk assessment for biochemical...Int J Cancer 2006 Mar 1;118(5): p1234-40
Structural Features
MWDLVLSIALSVGCTGAVPLIQSRIVGGWECEKHSQPWQVAVYSHGWAHCGGVLVHPQWVLTAAHCLKKNSQVWLGRHNL
FEPEDTGQRVPVSHSFPHPLYNMSLLKHQSLRPDEDSSHDLMLLRLSEPAKITDVVKVLGLPTQEPALGTTCYASGWGSI
EPEEFLRPRSLQCVSLHLLSNDMCARAYSEKVTEFMLCAGLWTGGKDTCGGDSGGPLVCNGVLQGITSWGPEPCALPEKP
AVYTKVVHYRKWIKDTIAANP
Cross annotation in other databases
KLK2 in:
- Gene Cards
- Diseases
- Expression
- SNP
- Drugs
- Other Links
- Human Protein Atlas
- iHOP
- GNF Sym Atlas
- NCBI Homologs
- OMIM
- MEROPS

