KLK5

Functional Attributes in Pathways

Recent News and Literature

  1. Activation of hepatocyte growth...FEBS J. 2008 Mar;275(5):1003-17. Epub 2008 Jan 25.
  2. Defining the extended substrate...Biol Chem. 2007 Nov;388(11):1215-25.
  3. Proteomics analysis of conditioned...Mol Cell Proteomics. 2007 Nov;6(11):1997-2011. Epub 2007 Jul 25.
  4. Association of KLK5 overexpression...Cancer Sci. 2007 Jul;98(7):1078-86. Epub 2007 Apr 24.
  5. Human tissue kallikreins: the...Cancer Lett. 2007 Apr 28;249(1):61-79. Epub 2007 Jan 31.
  6. Expression analysis and prognostic...Clin Chim Acta. 2005 Jul 24;357(2):190-5.
  7. KLK5 and KLK7, two...Biochem Biophys Res Commun 2005 Apr 22;329(4): p1260-6
  8. Biochemical and enzymatic characterization...J Biol Chem 2005 Apr 15;280(15): p14628-35
  9. Intron retention: a common...Clin Chem 2005 Mar;51(3): p506-15
  10. The kallikrein gene 5...Tumour Biol 2004 Sep-Dec;25(5-6): p221-7
  11. The human kallikrein protein...Biochim Biophys Acta 2003 Jul 28;1628(2): p88-96
  12. Human tissue kallikreins and...APMIS 2003 Jan;111(1): p225-32; discussion 232-3
  13. Differential splicing of KLK5...Clin Cancer Res 2003 May;9(5): p1710-20
  14. Down-regulation of the human...Prostate 2002 May 1;51(2): p126-32

Structural Features

Structure has not yet been determined for this protein.



Click here to view a 3D model

[-] Domain Structure

Homologs

Sequence

MATARPPWMWVLCALITALLLGVTEHVLANNDVSCDHPSNTVPSGSNQDLGAGAGEDARSDDSSSRIINGSDCDMHTQPW

QAALLLRPNQLYCGAVLVHPQWLLTAAHCRKKVFRVRLGHYSLSPVYESGQQMFQGVKSIPHPGYSHPGHSNDLMLIKLN

RRIRPTKDVRPINVSSHCPSAGTKCLVSGWGTTKSPQVHFPKVLQCLNISVLSQKRCEDAYPRQIDDTMFCAGDKAGRDS

CQGDSGGPVVCNGSLQGLVSWGDYPCARPNRPGVYTNLCKFTKWIQETIQANS

Cross annotation in other databases

KLK5 in: