HIV-1 retropepsin
Functional Attributes in Pathways
-
Substrates : 56 entries in CutDB for A02.001
Ext
-
actin, alpha skeletal muscle
-
alpha 2 actin
-
amyloid beta A4 protein isoform a precursor
-
amyloid beta A4 protein isoform b precursor
-
amyloid beta A4 protein isoform c precursor
-
amyloid beta A4 protein isoform e precursor
-
amyloid beta A4 protein isoform f precursor
-
C1 inhibitor (Homo sapiens)
-
calmodulin 1 (phosphorylase kinase, delta)
-
capsid
-
caspase 8 isoform A precursor
-
caspase 8 isoform B precursor
-
caspase 8 isoform C precursor
-
caspase 8 isoform G precursor
-
eukaryotic translation initiation factor 4 gamma, 1 isoform 1
-
eukaryotic translation initiation factor 4 gamma, 1 isoform 2
-
eukaryotic translation initiation factor 4 gamma, 1 isoform 3
-
eukaryotic translation initiation factor 4 gamma, 1 isoform 4
-
feline immunodeficiency virus gag polyprotein-derived peptide 11
-
Gag-Pol
-
interleukin 1, beta proprotein
-
moesin
-
phosphorylase b kinase regulatory subunit alpha, skeletal muscle isoform
-
proinsulin precursor
-
ribonuclease
-
troponin C type 2 (fast)
-
Substrate Specificity -- Under development
-
Inhibitors -- Under development
-
Pathways -- Under development
Recent News and Literature
We currently do not have custom news for this protein.
Structural Features
QITLWQRPLVQVRIEGQLIEALLDTGADDTVLEDINLPGRWKPKMIGGIGGFIKVRQYDQIPIEICGKKAIGTVLVGPTP
VNIIGRNMLTQIGCTLNF
Cross annotation in other databases
HIV-1 retropepsin in:
Gene Cards
- Diseases
- Expression
- SNP
- Drugs
Other Links
- NCBI Homologs
- OMIM
- MEROPS
Functional Attributes in Pathways
-
Substrates : 56 entries in CutDB for A02.001
Ext
- actin, alpha skeletal muscle
- alpha 2 actin
- amyloid beta A4 protein isoform a precursor
- amyloid beta A4 protein isoform b precursor
- amyloid beta A4 protein isoform c precursor
- amyloid beta A4 protein isoform e precursor
- amyloid beta A4 protein isoform f precursor
- C1 inhibitor (Homo sapiens)
- calmodulin 1 (phosphorylase kinase, delta)
- capsid
- caspase 8 isoform A precursor
- caspase 8 isoform B precursor
- caspase 8 isoform C precursor
- caspase 8 isoform G precursor
- eukaryotic translation initiation factor 4 gamma, 1 isoform 1
- eukaryotic translation initiation factor 4 gamma, 1 isoform 2
- eukaryotic translation initiation factor 4 gamma, 1 isoform 3
- eukaryotic translation initiation factor 4 gamma, 1 isoform 4
- feline immunodeficiency virus gag polyprotein-derived peptide 11
- Gag-Pol
- interleukin 1, beta proprotein
- moesin
- phosphorylase b kinase regulatory subunit alpha, skeletal muscle isoform
- proinsulin precursor
- ribonuclease
- troponin C type 2 (fast)
- Substrate Specificity -- Under development
- Inhibitors -- Under development
- Pathways -- Under development
Recent News and Literature
Structural Features
QITLWQRPLVQVRIEGQLIEALLDTGADDTVLEDINLPGRWKPKMIGGIGGFIKVRQYDQIPIEICGKKAIGTVLVGPTP
VNIIGRNMLTQIGCTLNF
Cross annotation in other databases
HIV-1 retropepsin in:
- Gene Cards
- Diseases
- Expression
- SNP
- Drugs
- Other Links
- NCBI Homologs
- OMIM
- MEROPS

