KLK10

Functional Attributes in Pathways

Recent News and Literature

  1. Proteomics analysis of conditioned...Mol Cell Proteomics. 2007 Nov;6(11):1997-2011. Epub 2007 Jul 25.
  2. Human kallikrein 10 ELISA...Clin Biochem. 2007 Sep;40(13-14):1057-62. Epub 2007 Jun 2.
  3. Downregulation and CpG island...Cancer Lett. 2007 Jun 18;251(1):78-85. Epub 2006 Dec 19.
  4. Expression of the human...Biol Chem. 2006 Jun;387(6):783-8.
  5. Human kallikrein 10, a...Biol Chem. 2006 Jun;387(6):715-21.
  6. [Expression and single nucleotide...Zhonghua Wai Ke Za Zhi. 2006 May 1;44(9):623-7.
  7. Gene expression in poorly...Thyroid. 2006 Feb;16(2):161-75.
  8. Overexpression of kallikrein 10...Am J Obstet Gynecol 2006 May;194(5): p1296-302
  9. Kallikreins as markers of...Tumour Biol 2006;27(2): p104-14
  10. Gene expression profiles in...Int J Cancer 2004 Oct 20;112(1): p14-25
  11. Selection of potential markers...Clin Cancer Res 2004 May 15;10(10): p3291-300
  12. Tissue kallikreins: new players...Thromb Haemost 2003 Jul;90(1): p7-16
  13. Overexpression of kallikrein 10...Gynecol Oncol 2003 Jul;90(1): p44-50
  14. Human tissue kallikreins and...APMIS 2003 Jan;111(1): p225-32; discussion 232-3
  15. Higher expression of human...Br J Cancer 2002 Jun 5;86(11): p1790-6

Structural Features

Structure has not yet been determined for this protein.



Click here to view a 3D model

[-] Domain Structure

Homologs

Sequence

MRAPHLHLSAASGARALAKLLPLLMAQLWAAEAALLPQNDTRLDPEAYGAPCARGSQPWQVSLFNGLSFHCAGVLVDQSW

VLTAAHCGNKPLWARVGDDHLLLLQGEQLRRTTRSVVHPKYHQGSGPILPRRTDEHDLMLLKLARPVVPGPRVRALQLPY

RCAQPGDQCQVAGWGTTAARRVKYNKGLTCSSITILSPKECEVFYPGVVTNNMICAGLDRGQDPCQSDSGGPLVCDETLQ

GILSWGVYPCGSAQHPAVYTQICKYMSWINKVIRSN

Cross annotation in other databases

KLK10 in: