MMP26
Functional Attributes in Pathways
-
Substrates : 20 entries in CutDB for M10.029
Ext
-
alpha1-proteinase inhibitor (Homo sapiens)
-
estrogen receptor beta isoform 1
-
estrogen receptor beta isoform 2
-
fibrinogen, alpha chain isoform alpha preproprotein
-
fibrinogen, alpha chain isoform alpha-E preproprotein
-
fibrinogen, alpha polypeptide isoform alpha-E preproprotein
-
fibrinogen, gamma chain isoform gamma-A precursor
-
fibronectin 1 isoform 1 preproprotein
-
Insulin-like growth factor binding protein 1 isoform a precursor
-
matrix metalloproteinase 26 preproprotein
-
Matrix metalloproteinase 9 preproprotein
-
serine (or cysteine) proteinase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1
-
vitronectin precursor
-
Substrate Specificity -- Under development
-
Inhibitors -- Under development
-
Pathways -- Under development
Recent News and Literature
- Additional MDA-MB-231 breast cancer...J Cell Physiol. 2008 Aug;216(2):480-5.
- Expression of MMP-9, MMP-10...J Cutan Pathol. 2007 Dec;34(12):889-98.
- Increased expression of matrix...Mod Pathol. 2007 Nov;20(11):1128-40. Epub 2007 Sep 14.
- Calcium regulates tertiary structure...Biochem J. 2007 Apr 1;403(1):31-42.
- Expression of matrix metalloproteinase-26...Int J Gynecol Cancer. 2006 Sep-Oct;16(5):1794-800.
- MMP-21 is expressed by macrophages...Exp Dermatol. 2006 Oct;15(10):775-83.
- Peaking of MMP-26 and TIMP-4...Cell Res. 2006 Sep;16(9):741.
- Coordinated peak expression of MMP-26...Cell Res. 2006 Sep;16(9):750-8.
- Oxytocin induces proliferation and migration...Mol Cancer Res. 2006 Jun;4(6):351-9.
- Matrix metalloproteinases 21 and 26 are differentially...Tumour Biol. 2006;27(3):133-41. Epub 2006 Apr 20.
- Matrix metalloproteinase 26 proteolysis...Cancer Res 2006 Mar 1;66(5): p2716-24
- Matrilysin-2 (matrix metalloproteinase-26) is upregulated...J Invest Dermatol 2005 Apr;124(4): p849-56
- Matrix metalloproteinase-26 is associated...Cancer Res 2004 Dec 1;64(23): p8657-65
- Matrix metalloproteinase-26 (matrilysin-2) expression...Gynecol Oncol 2004 Sep;94(3): p661-70
- MRP-1/CD9 gene transduction downregulates...Oncogene 2004 Sep 30;23(45): p7475-83
- Association of matrilysin-2 (MMP-26)...Carcinogenesis 2004 Dec;25(12): p2353-60
- Differential expression of three...Dig Dis Sci 2004 Apr;49(4): p653-61
- Endometase/matrilysin-2 in human breast...Cancer Res 2004 Jan 15;64(2): p590-8
- Differential expression of matrilysin-1...J Pathol 2004 Jan;202(1): p14-22
- Expression of matrix metalloproteinase-26...Gynecol Oncol 2003 Jun;89(3): p453-9
Structural Features
MQLVILRVTIFLPWCFAVPVPPAADHKGWDFVEGYFHQFFLTKKESPLLTQETQTQLLQQFHRNGTDLLDMQMHALLHQP
HCGVPDGSDTSISPGRCKWNKHTLTYRIINYPHDMKPSAVKDSIYNAVSIWSNVTPLIFQQVQNGDADIKVSFWQWAHED
GWPFDGPGGILGHAFLPNSGNPGVVHFDKNEHWSASDTGYNLFLVATHEIGHSLGLQHSGNQSSIMYPTYWYHDPRTFQL
SADDIQRIQHLYGEKCSSDIP
Cross annotation in other databases
MMP26 in:
Gene Cards
- Diseases
- Expression
- SNP
- Drugs
Other Links
- Human Protein Atlas
- iHOP
- GNF Sym Atlas
- NCBI Homologs
- OMIM
- MEROPS
Functional Attributes in Pathways
-
Substrates : 20 entries in CutDB for M10.029
Ext
- alpha1-proteinase inhibitor (Homo sapiens)
- estrogen receptor beta isoform 1
- estrogen receptor beta isoform 2
- fibrinogen, alpha chain isoform alpha preproprotein
- fibrinogen, alpha chain isoform alpha-E preproprotein
- fibrinogen, alpha polypeptide isoform alpha-E preproprotein
- fibrinogen, gamma chain isoform gamma-A precursor
- fibronectin 1 isoform 1 preproprotein
- Insulin-like growth factor binding protein 1 isoform a precursor
- matrix metalloproteinase 26 preproprotein
- Matrix metalloproteinase 9 preproprotein
- serine (or cysteine) proteinase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1
- vitronectin precursor
- Substrate Specificity -- Under development
- Inhibitors -- Under development
- Pathways -- Under development
Recent News and Literature
- Additional MDA-MB-231 breast cancer...J Cell Physiol. 2008 Aug;216(2):480-5.
- Expression of MMP-9, MMP-10...J Cutan Pathol. 2007 Dec;34(12):889-98.
- Increased expression of matrix...Mod Pathol. 2007 Nov;20(11):1128-40. Epub 2007 Sep 14.
- Calcium regulates tertiary structure...Biochem J. 2007 Apr 1;403(1):31-42.
- Expression of matrix metalloproteinase-26...Int J Gynecol Cancer. 2006 Sep-Oct;16(5):1794-800.
- MMP-21 is expressed by macrophages...Exp Dermatol. 2006 Oct;15(10):775-83.
- Peaking of MMP-26 and TIMP-4...Cell Res. 2006 Sep;16(9):741.
- Coordinated peak expression of MMP-26...Cell Res. 2006 Sep;16(9):750-8.
- Oxytocin induces proliferation and migration...Mol Cancer Res. 2006 Jun;4(6):351-9.
- Matrix metalloproteinases 21 and 26 are differentially...Tumour Biol. 2006;27(3):133-41. Epub 2006 Apr 20.
- Matrix metalloproteinase 26 proteolysis...Cancer Res 2006 Mar 1;66(5): p2716-24
- Matrilysin-2 (matrix metalloproteinase-26) is upregulated...J Invest Dermatol 2005 Apr;124(4): p849-56
- Matrix metalloproteinase-26 is associated...Cancer Res 2004 Dec 1;64(23): p8657-65
- Matrix metalloproteinase-26 (matrilysin-2) expression...Gynecol Oncol 2004 Sep;94(3): p661-70
- MRP-1/CD9 gene transduction downregulates...Oncogene 2004 Sep 30;23(45): p7475-83
- Association of matrilysin-2 (MMP-26)...Carcinogenesis 2004 Dec;25(12): p2353-60
- Differential expression of three...Dig Dis Sci 2004 Apr;49(4): p653-61
- Endometase/matrilysin-2 in human breast...Cancer Res 2004 Jan 15;64(2): p590-8
- Differential expression of matrilysin-1...J Pathol 2004 Jan;202(1): p14-22
- Expression of matrix metalloproteinase-26...Gynecol Oncol 2003 Jun;89(3): p453-9
Structural Features
MQLVILRVTIFLPWCFAVPVPPAADHKGWDFVEGYFHQFFLTKKESPLLTQETQTQLLQQFHRNGTDLLDMQMHALLHQP
HCGVPDGSDTSISPGRCKWNKHTLTYRIINYPHDMKPSAVKDSIYNAVSIWSNVTPLIFQQVQNGDADIKVSFWQWAHED
GWPFDGPGGILGHAFLPNSGNPGVVHFDKNEHWSASDTGYNLFLVATHEIGHSLGLQHSGNQSSIMYPTYWYHDPRTFQL
SADDIQRIQHLYGEKCSSDIP
Cross annotation in other databases
MMP26 in:
- Gene Cards
- Diseases
- Expression
- SNP
- Drugs
- Other Links
- Human Protein Atlas
- iHOP
- GNF Sym Atlas
- NCBI Homologs
- OMIM
- MEROPS

