protein serine kinase c17 {{Homo sapiens}}

Functional Attributes in Pathways

Recent News and Literature

    We currently do not have custom news for this protein.

Structural Features

Structure has not yet been determined for this protein.



Click here to view a 3D model

GVYAPPVGGFSFDNCRRMPSWKPILQMRGYKLPKARKTGTTIAGVVYKDGIVLGADTEQLKGWLLLDNGCSKIHFISPNI

YCCGAGTADTDMTTQLISSNLELHSLSTGRLPRVVTAKSDAEADAFQVSRLLGAALVLGGVDV

Cross annotation in other databases

protein serine kinase c17 {{Homo sapiens}} in: