Caspase 4
Functional Attributes in Pathways
-
Substrates : 5 entries in CutDB for C14.007
Ext
-
Substrate Specificity -- Under development
-
Inhibitors -- Under development
-
Pathways -- Under development
Recent News and Literature
- Tumor necrosis factor-alpha can provoke...J Biol Chem. 2008 Sep 12;283(37):25638-49. Epub 2008 Jul 17.
- Mutational analysis of caspase...Hum Pathol. 2008 Apr 18;.
- The cephalostatin way of apoptosis....J Nat Prod. 2008 Mar;71(3):482-6. Epub 2008 Feb 8.
- HIV-1 protease inhibitors nelfinavir...Cancer Res. 2007 Nov 15;67(22):10920-8.
- Calcium and survivin are involved...Methods Find Exp Clin Pharmacol. 2007 Jan-Feb;29(1):33-8.
- Curcumin induces pro-apoptotic endoplasmic...Biochem Biophys Res Commun. 2007 Feb 23;353(4):1040-5. Epub 2006 Dec 27.
- The proteasome inhibitor NPI-0052...Mol Cancer Ther. 2006 Jul;5(7):1836-43.
- Effect of hepatitis C virus...Mol Med. 2006 Jan-Mar;12(1-3):47-53.
- In vitro and in vivo...Clin Cancer Res. 2006 Jun 1;12(11 Pt 1):3485-93.
- Proteomic analysis and the antimetastatic...Arch Pharm Res. 2006 Mar;29(3):224-34.
- Vitamin E succinate suppresses...Int J Cancer. 2006 May 15;118(10):2441-7.
- Bortezomib inhibits PKR-like endoplasmic...Cancer Res. 2005 Dec 15;65(24):11510-9.
- Cleavage of p53-vimentin complex...Am J Pathol 2005 Sep;167(3): p705-19
- Leukemia inhibitory factor triggers...Int J Biochem Cell Biol 2005 Nov;37(11): p2284-96
- Proteomics analysis of H-RAS-mediated...Oncogene. 2005 Sep 8;24(40):6174-84.
- A novel isoform of pro-interleukin-18...Oncogene 2004 Sep 30;23(45): p7552-60
- Proinflammatory cytokines in the course...J Infect Dis 2002 Nov 1;186(9): p1277-82
- Gene expression profiling in chronic...Leuk Lymphoma. 2002 Jun;43(6):1289-95.
- Interleukin-1F7B (IL-1H4/IL-1F7) is processed...Cytokine 2002 Apr 21;18(2): p61-71
- Cytokine regulation of human...Am J Physiol Gastrointest Liver Physiol 2002 Jan;282(1): pG92-G104
Structural Features
MAEGNHRKKPLKVLESLGKDFLTGVLDNLVEQNVLNWKEEEKKKYYDAKTEDKVRVMADSMQEKQRMAGQMLLQTFFNID
QISPNKKAHPNMEAGPPESGESTDALKLCPHEEFLRLCKERAEEIYPIKERNNRTRLALIICNTEFDHLPPRNGADFDIT
GMKELLEGLDYSVDVEENLTARDMESALRAFATRPEHKSSDSTFLVLMSHGILEGICGTVHDEKKPDVLLYDTIFQIFNN
RNCLSLKDKPKVIIVQACRGANRGELWVRDSPASLEVASSQSSENLEEDAVYKTHVEKDFIAFCSSTPHNVSWRDSTMGS
IFITQLITCFQKYSWCCHLEEVFRKVQQSFETPRAKAQMPTIERLSMTRYFYLFPGN
Cross annotation in other databases
Caspase 4 in:
Gene Cards
- Diseases
- Expression
- SNP
- Drugs
Other Links
- Human Protein Atlas
- iHOP
- GNF Sym Atlas
- NCBI Homologs
- OMIM
- MEROPS
Functional Attributes in Pathways
- Substrates : 5 entries in CutDB for C14.007 Ext
- Substrate Specificity -- Under development
- Inhibitors -- Under development
- Pathways -- Under development
Recent News and Literature
- Tumor necrosis factor-alpha can provoke...J Biol Chem. 2008 Sep 12;283(37):25638-49. Epub 2008 Jul 17.
- Mutational analysis of caspase...Hum Pathol. 2008 Apr 18;.
- The cephalostatin way of apoptosis....J Nat Prod. 2008 Mar;71(3):482-6. Epub 2008 Feb 8.
- HIV-1 protease inhibitors nelfinavir...Cancer Res. 2007 Nov 15;67(22):10920-8.
- Calcium and survivin are involved...Methods Find Exp Clin Pharmacol. 2007 Jan-Feb;29(1):33-8.
- Curcumin induces pro-apoptotic endoplasmic...Biochem Biophys Res Commun. 2007 Feb 23;353(4):1040-5. Epub 2006 Dec 27.
- The proteasome inhibitor NPI-0052...Mol Cancer Ther. 2006 Jul;5(7):1836-43.
- Effect of hepatitis C virus...Mol Med. 2006 Jan-Mar;12(1-3):47-53.
- In vitro and in vivo...Clin Cancer Res. 2006 Jun 1;12(11 Pt 1):3485-93.
- Proteomic analysis and the antimetastatic...Arch Pharm Res. 2006 Mar;29(3):224-34.
- Vitamin E succinate suppresses...Int J Cancer. 2006 May 15;118(10):2441-7.
- Bortezomib inhibits PKR-like endoplasmic...Cancer Res. 2005 Dec 15;65(24):11510-9.
- Cleavage of p53-vimentin complex...Am J Pathol 2005 Sep;167(3): p705-19
- Leukemia inhibitory factor triggers...Int J Biochem Cell Biol 2005 Nov;37(11): p2284-96
- Proteomics analysis of H-RAS-mediated...Oncogene. 2005 Sep 8;24(40):6174-84.
- A novel isoform of pro-interleukin-18...Oncogene 2004 Sep 30;23(45): p7552-60
- Proinflammatory cytokines in the course...J Infect Dis 2002 Nov 1;186(9): p1277-82
- Gene expression profiling in chronic...Leuk Lymphoma. 2002 Jun;43(6):1289-95.
- Interleukin-1F7B (IL-1H4/IL-1F7) is processed...Cytokine 2002 Apr 21;18(2): p61-71
- Cytokine regulation of human...Am J Physiol Gastrointest Liver Physiol 2002 Jan;282(1): pG92-G104
Structural Features
MAEGNHRKKPLKVLESLGKDFLTGVLDNLVEQNVLNWKEEEKKKYYDAKTEDKVRVMADSMQEKQRMAGQMLLQTFFNID
QISPNKKAHPNMEAGPPESGESTDALKLCPHEEFLRLCKERAEEIYPIKERNNRTRLALIICNTEFDHLPPRNGADFDIT
GMKELLEGLDYSVDVEENLTARDMESALRAFATRPEHKSSDSTFLVLMSHGILEGICGTVHDEKKPDVLLYDTIFQIFNN
RNCLSLKDKPKVIIVQACRGANRGELWVRDSPASLEVASSQSSENLEEDAVYKTHVEKDFIAFCSSTPHNVSWRDSTMGS
IFITQLITCFQKYSWCCHLEEVFRKVQQSFETPRAKAQMPTIERLSMTRYFYLFPGN
Cross annotation in other databases
Caspase 4 in:
- Gene Cards
- Diseases
- Expression
- SNP
- Drugs
- Other Links
- Human Protein Atlas
- iHOP
- GNF Sym Atlas
- NCBI Homologs
- OMIM
- MEROPS

