Caspase 2

Functional Attributes in Pathways

Recent News and Literature

  1. Up-regulation of the proapoptotic...Proc Natl Acad Sci U S A. 2008 Oct 7.
  2. Caspase-2 functions upstream of mitochondria...Mol Cancer Ther. 2008 Aug;7(8):2298-307.
  3. PRIMA-1(MET) induces mitochondrial apoptosis...Oncogene. 2008 Jul 28.
  4. E1A Oncogene Enhancement of Caspase-2-Mediated...J Immunol. 2008 Jun 15;180(12):8272-9.
  5. Chk1 Suppresses a Caspase-2...Cell. 2008 May 30;133(5):864-77.
  6. Polypyrimidine tract-binding protein (PTB)...J Biol Chem. 2008 Jul 18;283(29):20277-87. Epub 2008 May 22.
  7. Caspase 2 is both...Cell Cycle. 2008 Feb 19;7(9).
  8. c-Myc and caspase-2 are involved...J Biol Chem. 2008 Mar 28;.
  9. Effect of proteasome inhibitors...Br J Dermatol. 2008 Jan 17;.
  10. Pterostilbene induces apoptosis and cell...J Agric Food Chem. 2007 Sep 19;55(19):7777-85. Epub 2007 Aug 16.
  11. Docetaxel-induced apoptosis of human...Clin Cancer Res. 2007 Feb 15;13(4):1308-14.
  12. Phellinus linteus activates different...Br J Cancer. 2007 Feb 26;96(4):583-90. Epub 2007 Jan 30.
  13. Differential growth inhibition and induction...Clin Exp Pharmacol Physiol. 2007 Mar;34(3):230-7.
  14. Combretastatin CA-4 and combretastatin...Apoptosis. 2007 Jan;12(1):155-66.
  15. Homeopathic medicines do not alter...Integr Cancer Ther. 2006 Dec;5(4):356-61.
  16. Effect of homeopathic treatment...Integr Cancer Ther. 2006 Dec;5(4):350-5.
  17. Potential use of alexidine...Mol Cancer Ther. 2006 Sep;5(9):2234-40.
  18. Beta-carotene: a colorful killer...Free Radic Biol Med. 2006 Aug 1;41(3):418-21. Epub 2006 May 11.
  19. Caspase-10 involvement in cytotoxic...Oncogene. 2006 Dec 7;25(58):7635-45. Epub 2006 Jun 12.
  20. In vitro and in vivo...Clin Cancer Res. 2006 Jun 1;12(11 Pt 1):3485-93.

Structural Features

[-] Domain Structure

Homologs

Sequence

MAADRGRRILGVCGMHPHHQETLKKNRVVLAKQLLLSELLEHLLEKDIITLEMRELIQAKVGSFSQNVELLNLLPKRGPQ

AFDAFCEALRETKQGHLEDMLLTTLSGLQHVLPPLSCDYDLSLPFPVCESCPLYKKLRLSTDTVEHSLDNKDGPVCLQVK

PCTPEFYQTHFQLAYRLQSRPRGLALVLSNVHFTGEKELEFRSGGDVDHSTLVTLFKLLGYDVHVLCDQTAQEMQEKLQN

FAQLPAHRVTDSCIVALLSHGVEGAIYGVDGKLLQLQEVFQLFDNANCPSLQNKPKMFFIQACRGDETDRGVDQQDGKNH

AGSPGCEESDAGKEKLPKMRLPTRSDMICGYACLKGTAAMRNTKRGSWYIEALAQVFSERACDMHVADMLVKVNALIKDR

EGYAPGTEFHRCKEMSEYCSTLCRHLYLFPGHPPT

Cross annotation in other databases

Caspase 2 in: